KEGG   Paraburkholderia phymatum: Bphy_3055Help
Entry
Bphy_3055         CDS       T00704                                 

Definition
(GenBank) transcriptional coactivator/pterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00790  Folate biosynthesis
bph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bphy_3055
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bph04147]
    Bphy_3055
Enzymes [BR:bph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Bphy_3055
Exosome [BR:bph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bphy_3055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ACC72223
UniProt: B2JJM5
Position
1:3432195..3432446
Genome map
AA seq 83 aa AA seqDB search
MRARSRNAPGCRTSRGHDAISRQFKFADFNEAFRFKTRVAIKAQQIDHHPFNVYSNVDIT
LSTHDANRISERAPFIDEVAAEN
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagccagatcgcgcaacgcaccgggctgcagaacgtcgaggggccacgacgcgatc
agtcggcaattcaagttcgccgacttcaacgaagcattccgcttcaagacgcgcgtcgcg
atcaaggctcagcagatcgaccatcaccctttcaacgtctacagtaacgtcgacatcacg
ctatcgacgcacgatgcgaatagaatttccgagcgcgcaccatttatcgatgaagtggca
gctgaaaactga

DBGET integrated database retrieval system