KEGG   Paraburkholderia phymatum: Bphy_3511Help
Entry
Bphy_3511         CDS       T00704                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00360  Phenylalanine metabolism
bph00362  Benzoate degradation
bph00620  Pyruvate metabolism
bph00621  Dioxin degradation
bph00622  Xylene degradation
bph00650  Butanoate metabolism
bph01100  Metabolic pathways
bph01120  Microbial metabolism in diverse environments
bph01220  Degradation of aromatic compounds
Module
bph_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bphy_3511
   00650 Butanoate metabolism
    Bphy_3511
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Bphy_3511
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bphy_3511
   00622 Xylene degradation
    Bphy_3511
   00621 Dioxin degradation
    Bphy_3511
Enzymes [BR:bph01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Bphy_3511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACC72660
UniProt: B2JLM7
Position
2:complement(447581..448528)
Genome map
AA seq 315 aa AA seqDB search
MKRKLKVAIIGSGNIGTDLMIKILRHGEHIEMGAMVGIDAASDGLQRAARLGVVTTHEGV
EGLSRMPVFADIDIVFDATSASAHTRNDAFLRAIKPGIRFVDLTPAAIGPYCIPVVNGER
HLDAPNVNMVTCGGQATIPMVAAVSRVARVRYAEIVASISSRSAGPGTRANIDEFTETTS
RAIEVVGGAAVGKAIIVLNPAEPPLIMRDTVYTLSEFVDERQIEESVTRMAEAVQTYVPG
YRLKQRVQFDRIDADGPIRIPGISDRMVGLKTSIYLEIEGAAHYLPAYAGNLDIMTSAAK
VTAEGVANRLLANKK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggaaactgaaggtcgccattatcggcagcggcaacattggcactgatctcatg
atcaagattttgcgacacggcgagcacatcgagatgggcgcgatggtgggaatcgacgca
gcatcggacggactccagcgcgctgcgcgcctcggggtggtcacgacgcacgagggcgtc
gaagggctcagtcgaatgccagtgttcgcggatatcgatatcgttttcgacgcaacgtcc
gcctcggcgcacacgcgcaatgacgcgttcctgcgcgccatcaagcccggcatccgcttc
gtggatctgactccggcggccatcggcccgtattgcatcccggtggtgaacggtgagcgc
caccttgatgcgcccaatgtcaacatggtgacttgtggtggtcaggcaaccattccgatg
gtcgccgctgtatcgagggtcgcgagagtccgttacgccgagatcgttgcttccatctcg
agcaggagcgccgggcccggcacgcgcgccaacatagatgagttcaccgagactacgtcc
cgggcaatcgaggtggtgggtggtgcggccgtgggcaaggcgatcatcgttctcaacccg
gcggaaccgccgctgatcatgcgcgatacggtgtacacgctcagtgaattcgtcgatgaa
cgccagatcgaggaatcagtgacccgcatggcggaggcggtccagacatacgtgcccggc
taccgtctgaagcagcgcgtgcagttcgaccgcatcgacgccgatgggccgatccggatt
ccgggcatcagcgaccgcatggtcggcctcaaaacctcgatttacctcgaaatcgagggc
gcggctcactatctgcccgcttacgccggcaacctcgacatcatgacgagtgccgcgaag
gtcacggccgagggagtcgccaaccgccttctggccaacaaaaagtga

DBGET integrated database retrieval system