KEGG   Paraburkholderia phymatum: Bphy_4922Help
Entry
Bphy_4922         CDS       T00704                                 

Definition
(GenBank) Propanoyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00071  Fatty acid degradation
bph00072  Synthesis and degradation of ketone bodies
bph00280  Valine, leucine and isoleucine degradation
bph00310  Lysine degradation
bph00362  Benzoate degradation
bph00380  Tryptophan metabolism
bph00620  Pyruvate metabolism
bph00630  Glyoxylate and dicarboxylate metabolism
bph00640  Propanoate metabolism
bph00650  Butanoate metabolism
bph00900  Terpenoid backbone biosynthesis
bph01100  Metabolic pathways
bph01110  Biosynthesis of secondary metabolites
bph01120  Microbial metabolism in diverse environments
bph01130  Biosynthesis of antibiotics
bph01200  Carbon metabolism
bph01212  Fatty acid metabolism
bph02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bphy_4922
   00630 Glyoxylate and dicarboxylate metabolism
    Bphy_4922
   00640 Propanoate metabolism
    Bphy_4922
   00650 Butanoate metabolism
    Bphy_4922
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bphy_4922
   00072 Synthesis and degradation of ketone bodies
    Bphy_4922
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bphy_4922
   00310 Lysine degradation
    Bphy_4922
   00380 Tryptophan metabolism
    Bphy_4922
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bphy_4922
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bphy_4922
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bphy_4922
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bph04147]
    Bphy_4922
Enzymes [BR:bph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bphy_4922
Exosome [BR:bph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bphy_4922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACC74020
UniProt: B2JSK0
Position
2:complement(2004566..2005726)
Genome map
AA seq 386 aa AA seqDB search
MNAPHIIGWGHTVFGKHDQVELEQLIRDAALPALHSADVQSKDIDAIFVGTFNGGFVPQD
FSASLVAVAIPEFRHTPAVRVENACATGSAAVFAALDAVESGRVKRALVIGLEKMNTLPG
AQIGDVLLKCSYFKEEGGKPGGMAGVFGDIATEYFSRFGDQSDALAAIAAKNHRNGVDNP
YAHLRRDLGFEFCRTVSDKNPSLAGPLRRTDCSPVSDGAAALVISMEPRPGTANVRWRAR
AHVNDFLPLSMRDRTRFEGAALAWSKGLERAGVSLADLNLVEAHDCFTMAELLQYEAMGL
APHGQGARIILDGVTAKDGKLPVNPSGGLKSRGHPIGATGVSQHVMMAMQLTGKAEAMQI
PRASLGAVFNMGGTAVSNYLSILEAA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcaccacatatcatcggctggggccataccgtcttcggcaaacacgatcaggtc
gagctggaacaactgatcagggacgccgcgctgcccgcgctgcacagcgcagacgtccag
tcaaaagacatcgatgccatcttcgttggcacctttaatggtggcttcgtcccgcaagac
ttcagcgcttccctcgtcgccgtagcgatccccgagttccgccatactcccgcagtccgt
gtcgagaacgcctgtgccaccggttcggccgccgtctttgcggcgctcgacgcagtggag
agcggacgggtcaagcgcgccctggtcattggcctggaaaagatgaacacccttcctggc
gcccagatcggtgatgtcctgctcaagtgttcgtattttaaggaagaaggcgggaaacca
ggtggcatggccggagtctttggagacatcgccaccgagtatttttcgcggttcggcgat
cagtccgatgcccttgcagctatcgccgcgaagaaccatcggaacggtgtcgacaatccg
tacgcccatctgcgccgcgatcttgggttcgaattctgccgaacggtgtccgacaagaac
ccgtctctcgccggtcccctgaggcgcaccgactgctcgccggtctcggacggcgccgcg
gcattggtcatttccatggagcctcgtccgggcactgccaatgtccgctggcgcgctcgc
gcacacgtcaacgactttctgccgctgtcgatgcgcgatcgcacccgattcgaaggggcg
gcgctcgcctggtcgaaggggctcgaaagggctggagtttcgctggccgatctgaacctc
gtcgaggcccacgactgcttcaccatggcagagttgctccagtatgaagcgatgggactt
gcaccgcatggacaaggggcacggatcattctggacggcgtcactgcaaaggacggcaag
ctgccggtcaatccgtcgggcggattgaaatcgcgtggccatccgattggtgccactggc
gtatcgcagcacgtgatgatggcaatgcaactcactggcaaggccgaagcgatgcagatt
ccgcgggcgagcctcggcgccgtgttcaacatgggaggcaccgcagtctccaattacctg
agcatcttggaggcagcatga

DBGET integrated database retrieval system