KEGG   Paraburkholderia phymatum: Bphy_5518
Entry
Bphy_5518         CDS       T00704                                 

Definition
(GenBank) periplasmic binding protein/LacI transcriptional regulator
  KO
K23508  galactofuranose transport system substrate-binding protein
Organism
bph  Paraburkholderia phymatum
Pathway
bph02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bph00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bphy_5518
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bph02000]
    Bphy_5518
Transporters [BR:bph02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    Bphy_5518
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3 ABC_sub_bind Aminotran_5 Helicase_C
Other DBs
NCBI-ProteinID: ACC74594
UniProt: B2JP41
Position
2:complement(2672194..2673162)
AA seq 322 aa
MKVATRLIAGLLVGAALTVAASVNSFAGDKQITLGFSQVGAESAWRTANTVSVKTSAKDA
GINLKFSDAQQKQENQIKAIRSFIAQKVDVIAFSPVVESGWEPVLTEAKNAKIPVILTDR
SIDVKDTSLYVTMIGSDFLEEGRRAGRWLEERYKNEAGPINIAELQGTVGSAPANDRHAG
LMEVIKNDPKFKIIASQSGDFTLAGGKQVMEAFAKTYGKQINVVYAHNDDMALGAIQAME
EAGIKPGKDVSVVSFDATKGGFEAMIAGKINVDVECSPLLGPQLMTAVKDVVAGKQLPKR
IVTNETVFPMSVAAQILPQRKY
NT seq 969 nt   +upstreamnt  +downstreamnt
atgaaagtcgccacgcgtctgatcgccggcctgctcgtcggagcggcgctcaccgtcgct
gccagcgtcaacagctttgccggggacaagcagatcaccttgggcttttcgcaggtcggt
gcagaaagcgcatggcgcactgcgaataccgtatcggtgaaaacctcagcaaaggatgcc
ggcatcaacctgaagttctcggacgcgcagcagaagcaggaaaaccagatcaaggcaatc
cgctcgttcatcgcgcagaaggtggacgtgatcgcgttctcgcccgtcgtcgagtccggc
tgggaacccgtgctgacggaggcgaagaacgcgaagatccccgtcattctcaccgaccgt
tccatcgacgtgaaagatacctcgctgtacgtgacgatgatcggctcggacttcctcgaa
gaaggccgccgcgcaggacgctggctcgaagagcgctacaagaacgaagcgggcccgatc
aacatcgccgagctgcagggcacggtcggttcggcgcctgccaacgaccgtcatgcgggc
ctgatggaagtgatcaagaacgatccgaagttcaagatcatcgcgtcgcaaagcggcgac
ttcacgctcgcgggaggcaagcaggtgatggaggcgttcgcgaagacctacggcaagcag
atcaacgtcgtctacgcgcataacgacgacatggcgctcggcgcgatccaggcgatggaa
gaagcgggcatcaagcccggcaaggacgtgagcgtcgtgtcgttcgacgcgaccaagggc
ggcttcgaagcgatgatcgccggcaagatcaacgtcgatgtcgagtgcagcccgctgctc
gggccgcaactgatgacggccgtcaaggacgtggtcgcgggcaagcagctgcccaagcgc
atcgtgaccaacgagaccgtgttcccgatgagcgtcgccgcgcagattctgccgcagcgc
aagtactga

DBGET integrated database retrieval system