KEGG   Paraburkholderia phymatum: Bphy_5529Help
Entry
Bphy_5529         CDS       T00704                                 

Definition
(GenBank) phosphoesterase
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00562  Inositol phosphate metabolism
bph00564  Glycerophospholipid metabolism
bph01100  Metabolic pathways
bph01110  Biosynthesis of secondary metabolites
bph02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Bphy_5529
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bphy_5529
   00565 Ether lipid metabolism
    Bphy_5529
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bphy_5529
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bph02042]
    Bphy_5529
Enzymes [BR:bph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     Bphy_5529
Bacterial toxins [BR:bph02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   Bphy_5529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: ACC74605
UniProt: B2JP52
Position
2:complement(2682042..2683499)
Genome map
AA seq 485 aa AA seqDB search
MSDDQSSNLPDPTRRKILAALAGSVALSACGGGGGSSGSTGATSGLPPDRANLPRPALPD
PATSGVDHIVLVTMENRSFDHMFGWVPNAEHQQTRQFTDAFGQKQTSFGLTSNASYGFQA
CSFSDPNHMYEAGRVHLANGAMNGFLLTPGTSITRGDLLPIGYFGAADLDFYRGAVTQYT
VCDYYMSGILSATFPNRLYLHSGETDRLNDTVDTSSLPTIWDRLDAKNISSTYYFHDVPF
TSLYGSRYVGRSRLFAEFLADAAAGNLPSFCMIDPSFGGEAQGTSNDDHPHADVRNGQVL
LGRIYDALRTSPNWSKTLMILVYDEWGGFMEHVVPPVKPVSTAEHTVGNDGRLGFRVPCM
LFGPRVRANFVSRYPFDPSSIHQLLAWRFGLDPLGVRASDATTFNMAYALDFSDAARTDA
PAIAVTQGTFGVACSVAGVIPGLGGVDHSQQIPSTAASEPTANAPGGRFADLRAKATALG
FPGGM
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgatcagtcttcgaatttacccgatcccacccgtcgcaagatcctggcggcg
cttgccggcagtgtggcgttgtcggcttgtggcggagggggcggatcgtcaggcagcacg
ggtgcgacgagcggcctcccgcccgatcgggcgaacctgccgcggcctgccttgcccgat
cctgccacgtcgggcgtcgatcacatcgtcctcgtcacgatggagaaccggtcgttcgat
catatgttcggttgggtaccgaatgccgaacatcagcagacgcgccagttcaccgacgct
ttcggtcaaaagcaaacgtcgttcggcttgacgtcgaatgcgtcatacggattccaggca
tgctcgttctccgacccgaaccatatgtacgaggcagggcgcgttcacctcgcgaatggt
gcgatgaacggctttctactgacgcccggcacgagcatcacgcgcggcgacctgctgccc
atcggctatttcggcgcggccgatctcgacttctaccgcggggctgtcacgcaatacacc
gtttgcgattactacatgagcggcattctgtccgccacgtttccgaaccgtctttatctg
cacagcggcgagaccgaccgcctcaatgacactgtggatacgtcttcgctgccgaccatc
tgggaccggctcgacgcgaagaacatttcgtcgacgtattacttccacgatgtcccgttc
acctcgctctacggctcgcgctatgtcggccgctcccggctgttcgctgagttccttgcc
gatgccgccgccggcaatctgccgtcgttctgcatgatcgatccgagtttcgggggggaa
gcgcagggcacatcgaacgacgatcatccgcatgcggacgtgcgcaacggacaggtgctg
ctcggccggatctacgacgcgctgcgcaccagtccgaactggagcaagacgctgatgatt
ctcgtgtatgacgaatggggcggctttatggagcatgtggttccgcccgtcaagcccgtg
tcgacggcggagcataccgttggcaacgatgggcgcctgggcttccgtgtgccgtgcatg
ctgttcgggccgcgcgtgcgcgccaatttcgtctcgcgctatccgttcgatcccagctca
attcatcaactgctggcatggcgtttcggtctcgatccgctcggtgtgcgggcgagcgac
gcgaccaccttcaatatggcctacgcgctcgatttcagcgacgctgcgcgaaccgacgca
cccgcgattgcagtgacacaaggcacgttcggcgtcgcgtgctcggttgcaggcgtcatc
cccggccttggcggcgtcgatcacagccagcagattccgtccactgccgcctccgaaccg
acggccaacgcgcccggcggacggtttgcagatctccgggcgaaagcaaccgcgctaggc
ttcccgggcggcatgtaa

DBGET integrated database retrieval system