KEGG   Paraburkholderia phymatum: Bphy_5681Help
Entry
Bphy_5681         CDS       T00704                                 

Definition
(GenBank) methylmalonate-semialdehyde dehydrogenase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00280  Valine, leucine and isoleucine degradation
bph00410  beta-Alanine metabolism
bph00562  Inositol phosphate metabolism
bph00640  Propanoate metabolism
bph01100  Metabolic pathways
bph01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Bphy_5681
   00562 Inositol phosphate metabolism
    Bphy_5681
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bphy_5681
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bphy_5681
Enzymes [BR:bph01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     Bphy_5681
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     Bphy_5681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC Sm_like
Motif
Other DBs
NCBI-ProteinID: ACC74753
UniProt: B2JUX5
Position
pBPHY01:172456..173967
Genome map
AA seq 503 aa AA seqDB search
MQAYTDSADVGHFIHGQRVSGTGTRSQAVFNPATGARARKLLLGEAADVEAAVASAKAAF
PKWADTPPIRRARVMLRFLELMNRHRDELAAIITAEHGKVFSDAQGEVSRGIDVIEFACG
IPQLLKGDYTEQVSTGIDNWTMRQPLGVVAGITPFNFPCMVPCWMFPVAIATGNAFILKP
SERDPSAALFMAGLLKEAGLPDGVFNVVQGDKVVVDALLTHPDVKAVSFVGSTPIANYIY
ETGAKYGKRVQALGGAKNHMVVMPDADLDKAVDALIGAAYGSAGERCMAISVALLVGDVA
DKIMPKLAERARTLIVKNGMEADAEMGPIVTRQALERIEGYIAEGVKEGATLVVDGRGLK
VPGHEDGFFTGGTLFDHVTPQMRIYKEEIFGPVLACVRVKDFTESVELINAHEFGNGVAC
FTSDGHIAREFGRRIEVGMVGINVPIPVPMAWHGFGGWKRSLFGDTHAYGEEGVRFYTKQ
KSIMQRWSESIEKGAEFAMPTAK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctataccgacagcgcagacgtgggtcatttcattcatggccagcgcgtcagc
ggcacgggaacccgtagccaggccgttttcaatcccgccacgggcgcgcgagcccgcaag
ctgctgctcggcgaagcggccgatgtcgaagcggccgtcgccagcgcgaaggctgcgttt
ccgaagtgggccgatacgccgcccatccgccgcgcgcgtgtcatgctgcgcttcctcgaa
ctgatgaaccgtcatcgcgacgaattggccgccatcatcacggccgagcacggcaaggtg
ttctcggacgcgcagggtgaagtgtcgcgcggcatcgacgtaatcgaatttgcatgcggc
attccgcaactgctgaagggcgactacacggaacaggtgtcgacgggtatcgataactgg
acgatgcgtcagccgctgggcgtcgtcgcgggtattacgccgttcaacttcccttgcatg
gtgccgtgctggatgttcccggtcgcgattgcgacgggtaacgcgttcattctgaagccg
agcgagcgcgatccgtcggctgcgctcttcatggccgggctgctgaaagaagccggcctg
cccgatggcgtgttcaatgtcgtgcagggcgacaaagtggtcgtggatgcattgctcacg
cacccggacgtcaaggcggtgagcttcgtcggctcgacgccgatcgcgaactacatctac
gaaacgggcgcgaagtacggcaagcgcgtgcaggcgctgggcggcgcgaagaatcatatg
gtggtgatgcccgatgccgatctcgacaaggccgtcgacgcgctgatcggcgccgcatac
ggatcggctggcgagcgctgcatggcgatttccgtcgcgctgctggtcggcgacgtggcc
gacaagatcatgccgaagctcgccgagcgcgcccgcacgctgatcgtgaagaacggcatg
gaggccgacgccgaaatgggcccgatcgttacgcgccaggcgctggagcggatcgaaggt
tatatcgccgaaggtgtgaaggaaggcgcgacgctcgtcgtcgacggtcgcggtctgaaa
gtgccgggtcatgaagacggcttcttcacgggcggcacgctgttcgatcacgtaacgccg
caaatgcgcatctacaaggaagagattttcgggccggtgttggcttgtgtgcgagtgaag
gactttacggaatccgtcgaactgatcaatgcgcatgagttcggcaatggcgtcgcgtgc
ttcacgagcgatggtcacatcgcacgcgagtttggccgccgcatcgaagtcggcatggtc
ggcatcaatgtgccgattcccgtgccgatggcatggcacggcttcggcggctggaagcgc
agtctgttcggcgatacgcatgcatacggcgaagaaggcgtgcgcttctatacgaagcag
aagtcgatcatgcagcgctggtcggagagtatcgagaagggtgccgagtttgcgatgccg
accgcgaaataa

DBGET integrated database retrieval system