KEGG   Paraburkholderia phymatum: Bphy_5979
Entry
Bphy_5979         CDS       T00704                                 

Definition
(GenBank) type VI secretion protein, EvpB/VC_A0108 family
  KO
K11900  type VI secretion system protein ImpC
Organism
bph  Paraburkholderia phymatum
Brite
KEGG Orthology (KO) [BR:bph00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bph02044]
    Bphy_5979
Secretion system [BR:bph02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bphy_5979
SSDB
Motif
Pfam: VipB VipB_2 DUF499
Other DBs
NCBI-ProteinID: ACC75042
UniProt: B2JVR5
Position
pBPHY01:511410..512918
AA seq 502 aa
MASNTAAGGAARETQTLDASAGAELSLLERIVHEGNMAVEPSQSGYAKKLIGQLASQILD
EGMRTSPDKSVVAMINERVAEIDKLLSDQLNAIMHDEAFQALEASWTGLHDMVYGTETGP
QLKLRLLNVTKKELLKDLETAVDHDMSTLFKKIYEEEYGTFGGAPYSLLIGDYSFGRHPQ
DIALLERISKVAAAAHAPFIASAAPGLFDLKSFTDLGVTRDLSKTFESAELAAWRSFRDS
EDSRYVSLVLPSYAARLPYGAKTKPVENFNFEEDVDGTDHGKYLWANSAYQLGLRITDAF
AKYSWATAIRGVEGGGKVDNMVAHTYKTGEGDIVLKCPTEVTITDRREKELNDLGFIALV
NSKGSNFATFFGGQTTNRPKVYNKDAANANAQLSARLPYVLAASRFAHYMKVIMRDKVGS
FQSRSDIESYLNNWVADYVLINPSASHAQKARFPLGEARVDVTEVPGKPGAYRATCFLKP
HFQMEELTASIRLVAELPAAAA
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcaagcaacactgcggccggcggcgccgcacgcgaaacgcagacactcgacgcttca
gcgggtgcggaactgagcctgctcgagcgcatcgttcatgaaggcaacatggcggtcgag
ccgtcgcaaagcggctacgcgaaaaagctgatcggtcagctcgcttcgcagattctcgac
gaaggcatgcgcaccagcccggacaagagcgtggtcgcaatgatcaacgaacgtgtcgct
gaaatcgacaaattgctgtcggaccagctaaacgcaatcatgcacgatgaagcgttccag
gcgctcgaagcctcatggacaggcttgcatgatatggtctacggcaccgaaaccggaccg
caattgaagcttcgcctgctgaatgtgacgaagaaggaactgctcaaggaccttgaaacg
gccgtcgaccacgacatgagcacgctcttcaagaaaatctatgaagaggaatacggcaca
ttcggtggtgcaccgtattcgctgctgatcggcgactattcgtttggccgtcatccgcag
gatatcgcgctgctcgagcgtatctccaaagtggctgctgccgcgcacgctccgtttatt
gcttcagcagcgcctggactgttcgatctgaaatcatttacggacctcggcgtcacccgc
gatctgtcgaagaccttcgaaagcgccgaactcgccgcatggcgcagcttccgcgattcg
gaagactcgcgttatgtttctctggtgctgccttcgtatgccgcgcgcctgccgtacgga
gcgaagacgaagcccgtcgagaacttcaatttcgaagaagatgtagacggtacggatcac
ggcaagtatctttgggcaaactcggcttaccagctcggcctgcgcatcaccgatgcgttc
gcgaagtacagctgggcgacggcgatccgcggcgtggaaggcggtggcaaggtcgacaac
atggtggcgcacacgtacaagaccggcgaaggcgacatcgttctcaaatgcccgactgaa
gtaacgatcacggatcgtcgcgagaaggaactgaacgacctcggtttcatcgcactggtg
aattcgaaaggctcgaacttcgcgaccttcttcggcggtcagacgaccaaccgtcccaag
gtctacaacaaggatgccgccaatgccaacgcgcagctttcggctcgcctgccgtacgtg
ctcgccgcgtcgcgcttcgcgcactacatgaaagtgatcatgcgcgacaaggtcggaagt
ttccagtcgcgcagcgatatcgaatcttatctgaacaactgggttgccgattacgtactg
atcaatccctcggcgtcgcacgctcagaaggcgcgtttcccgctgggcgaagcacgtgtg
gacgtgacggaagtgccgggcaagccgggcgcataccgcgcgacctgcttcctgaaaccg
catttccagatggaagagttgaccgcgtcgattcgtctcgtcgcggaactgccggcagcg
gcagcctga

DBGET integrated database retrieval system