KEGG   Paraburkholderia phymatum: Bphy_5994Help
Entry
Bphy_5994         CDS       T00704                                 

Definition
(GenBank) type VI secretion protein, VC_A0114 family
  KO
K11893  type VI secretion system protein ImpJ
Organism
bph  Paraburkholderia phymatum
Brite
KEGG Orthology (KO) [BR:bph00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bph02044]
    Bphy_5994
Secretion system [BR:bph02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bphy_5994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: ACC75057
UniProt: B2JVT0
Position
pBPHY01:527884..529218
Genome map
AA seq 444 aa AA seqDB search
MMHDANMAVTDRIEWFEGMLLSPQHFQQMASRVDSLVAWQTLAAAPFSWGVRRLVLDHGL
LPAGLLRVLELDAIMPDGTAVTYSAEAQGAVRLELSLEPFAASLTSGPIDFYLVLPVAGT
MRRSAQVKRFRSSAGMPVEDQVSDAPPADIPRLMPNLALAAGELPSAMHVYLRLGSLYRD
NEVVRLGEHLPPLLEVARDNPLWTSVASLLGQLRGKAAFVARQTANPSSKVDDRLTQLEL
KDRLRSLLSALPLAEAVLRTPHLHPLSLYLSLASLNGSLAMLKPGGLPPVPPDYDHADPL
SVFTPLLRSLRESMSEVNEAYREHKFEFRHGAFEIALHPDWIGERLVVGLRGQSDRDLLA
WMDGAVIGSQSVYASLRSRRVLGAARRGIDYAEDLGLRSGSGYLLFEVEAEHALVLASEL
LVIGNPNEGASAQRPQEMLLFVKG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgatgcatgacgccaacatggcggtgaccgaccgtatcgaatggtttgaaggcatgctg
ctctcgccgcagcatttccagcaaatggcgtcgcgtgtcgattcgctcgtggcctggcag
acgcttgccgccgcgccgttcagctggggcgtccggcgtctggtgttggaccacggtctg
ctccccgcgggtctgctgcgcgtgctcgaactcgacgcgatcatgcccgacggcacggct
gtgacgtatagcgccgaagcgcaaggcgcagtgcgccttgaactgtcgctcgaacccttt
gcggcatcgctcacgagcgggccgatcgatttctatcttgtcctgcccgtcgcgggcacg
atgcgccgcagcgcccaggtcaaacgcttccgttcgagtgcgggtatgcccgtcgaggat
caggtctctgacgcaccgcccgccgatatccctcgcctcatgccgaatctcgcgcttgcc
gcgggcgaattgccgtcggccatgcatgtctacctgcgcctcggctcgctatacagggac
aatgaggtcgtacggctcggcgagcatttgccaccgttgctggaagtggcgcgcgacaat
ccgctgtggacaagcgtcgcgtccctgcttgggcaactgcgcggcaaggcggcgttcgtc
gcgcggcagactgcgaatccttcgtcgaaggtcgacgatcgcctgacgcaactcgaactc
aaggaccggctgcgcagcctgctgagcgcgctgccgctcgcagaagccgtgctgcgcaca
ccgcatcttcatccgctgtcgctctatctgtcgctggcgtcgcttaacggatcgctcgcg
atgctcaagccgggtggcctgccgcccgtgccgcccgactacgatcacgcggacccgctt
tctgtgttcacgccgctgttgcgttcgctgcgcgaatcgatgtcggaagtcaacgaagcg
tatcgcgagcacaagttcgaattccgccacggggccttcgaaatcgcgctgcatccggac
tggatcggcgagcgtctggtggtcggcctgcgcggtcagtcggatcgcgacctgctggcg
tggatggatggcgccgtcatcggttctcaatcggtctatgcgtcgttgcgcagccgccgc
gtgctgggcgccgcgcgccgcgggatcgactatgccgaggatctcggcctgcgttcgggc
tcggggtatctgctcttcgaagtcgaggccgagcacgcgctggtgctggcgagcgaactg
ctggtgatcggcaaccccaacgagggcgcgagcgcgcagcggccacaggaaatgctgctg
ttcgtgaagggatga

DBGET integrated database retrieval system