KEGG   Paraburkholderia phymatum: Bphy_6113
Entry
Bphy_6113         CDS       T00704                                 

Definition
(GenBank) type VI secretion protein, EvpB/VC_A0108 family
  KO
K11900  type VI secretion system protein ImpC
Organism
bph  Paraburkholderia phymatum
Brite
KEGG Orthology (KO) [BR:bph00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bph02044]
    Bphy_6113
Secretion system [BR:bph02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bphy_6113
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: ACC75170
UniProt: B2JW43
Position
pBPHY01:complement(663703..665196)
AA seq 497 aa
MAKQHAQTAVAGVATGSDFTQLLNQEFRPKTQQAREAVELAVQTLAEQALRQSATISDDA
YKSIAAIIAQIDHKLSEQINLILHHDDYQKLESAWRGLHHLVSNTETDERLKIRFMDISK
DELRRTMKRYKGLAWDQSPLFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLGSIA
KISAAAHTPFISGASPAVLQMESWQELANPRDLTKIFTQNLEYAPWNSLRNTEDARYIGL
AMPRFLARLPYGAKTNPVDEFDFEEDTAGSDHRHYAWSNAAYAMGVNINRSFKLYGWCSL
IRGVESGGTVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELSKNGFIPLIHRKNTDHA
TFIGAQSMQKPAEYHDADATANANLSARLPYLFACSRFAHYLKCIVRDKIGAFKEREDMQ
RWLNEWIMNYVDADPANSSQETKARRPLAAAEVLVEEVEGNPGYYQAKFFLRPHFQLEGL
TVSLRLVAKLPSIKEAA
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggcaaaacagcatgcacagacagcggtggccggcgtcgcaaccggttcggacttcacc
cagttgctcaaccaggaattccggccgaagacccaacaggcacgcgaagccgtcgaactc
gccgtccagacgctcgccgaacaggcgctccgtcaatcagccaccatcagcgacgatgcg
tacaagagcatcgcggccatcattgcacagatcgatcacaagctctccgagcagatcaac
ctgatcctgcaccacgacgattaccagaagctggaatcggcctggcgtggtctgcatcac
ctcgtctccaatacggaaacggatgagcgcctgaagatccgcttcatggacatctcgaag
gacgagctgcgccgcacgatgaagcgctacaagggcctcgcatgggaccagagcccgctc
ttcaagcagatctacgaagaagagtacggccagctcggtggcgagccgtacggctgtctc
gtcgcggactactacttcgaccacacaccgccggacgtcgacctgctcggctcgatcgcc
aagatctcggccgcagcccacaccccgttcatctcgggcgcgtcgcccgccgtgctgcag
atggaatcgtggcaggagctcgccaatccgcgcgacctcacgaagatcttcacgcagaac
ctcgaatatgccccgtggaactcgctacgcaacaccgaggacgcgcgctatatcggtctt
gcgatgccgcgcttcctggcgcgcctgccgtatggggcaaaaacgaacccggtcgacgaa
ttcgacttcgaggaagacaccgcgggctcggatcaccgtcactacgcatggtccaacgcg
gcctacgcgatgggcgtgaacatcaaccgctcgttcaagctgtacggctggtgctcgctg
atccgcggcgtggaatcgggtggcacggtcgaaaacctgccctgccacacgttcccgacg
gacgatggcggcgtcgacatgaagtgcccgaccgaaatcgccatctcggatcgccgcgag
gcggagctgtcgaagaacggtttcatcccgctcattcaccgcaagaacaccgaccacgcg
accttcatcggtgcgcagtcgatgcagaagccggccgagtaccacgatgctgacgcaacc
gctaacgcgaacctgtccgcgcgcctgccgtacctgttcgcctgctcgcgtttcgcgcat
tacttgaagtgcatcgtgcgagacaagatcggtgcgttcaaggagcgtgaggacatgcag
cgctggctcaacgaatggatcatgaactacgttgacgccgacccggccaactcgtcgcag
gaaaccaaggcccgtcgtccgctcgccgcagccgaggtgctcgtcgaggaagtggaaggc
aaccctggctactaccaggcgaagttcttcctgcgtccgcacttccagctcgaaggcctg
accgtgtcactgcgcttggtcgcgaagctgccgtcgatcaaggaagccgcctga

DBGET integrated database retrieval system