KEGG   Paraburkholderia phymatum: Bphy_6480Help
Entry
Bphy_6480         CDS       T00704                                 

Definition
(GenBank) transcriptional coactivator/pterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00790  Folate biosynthesis
bph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bphy_6480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bph04147]
    Bphy_6480
Enzymes [BR:bph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Bphy_6480
Exosome [BR:bph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bphy_6480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a DUF346
Motif
Other DBs
NCBI-ProteinID: ACC75510
UniProt: B2JX33
Position
pBPHY01:1060788..1061174
Genome map
AA seq 128 aa AA seqDB search
MTQSEQVYSDEEVQKKLEGPLQHWYLEDGWLRRKYRTESWKGTLMVVNTVGHLAEAAWHH
PDLTVSYAFVIVKLKTHTAKGITDKDFALARKIEEVIQWQPGKEGGPLEGTPADDQRFRY
IKYDAPKS
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaagcgaacaggtgtattccgacgaggaagtccagaagaagctcgaaggtccg
ttgcagcactggtatctcgaagacggctggctgcgtcgcaagtaccgcacggaaagctgg
aaaggcacgctgatggtcgtcaacaccgtcggccatctggcggaagctgcgtggcatcac
ccggatctgacggtgtcgtatgcgttcgtcatcgtgaagctgaagacgcataccgcgaaa
ggcatcaccgacaaggacttcgcgctggcgcgcaagatcgaggaagtgatccagtggcag
ccgggcaaggaaggcggtccgctcgaaggcacccccgccgacgatcagcggttccgctat
atcaagtacgacgcgccgaagagttga

DBGET integrated database retrieval system