KEGG   Paraburkholderia phymatum: Bphy_6497Help
Entry
Bphy_6497         CDS       T00704                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00630  Glyoxylate and dicarboxylate metabolism
bph01100  Metabolic pathways
bph01110  Biosynthesis of secondary metabolites
bph01120  Microbial metabolism in diverse environments
bph01130  Biosynthesis of antibiotics
bph01200  Carbon metabolism
Module
bph_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bphy_6497
Enzymes [BR:bph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Bphy_6497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ACC75527
UniProt: B2JX50
Position
pBPHY01:complement(1077538..1079043)
Genome map
AA seq 501 aa AA seqDB search
MNDFSKEAVKPADSATAAAKAEKRSRYAAGVMKYREMGYWQPDYTPKDTDVIALFRITPQ
PGVEPEEAAAAVAGESSTATWTVVWTDRLTACDMYRAKAFRVEPVPNPAEGEPQYFAFIA
YELDLFEEGSVANLTASIIGNVFGFKPLKALRLEDMRIPVAYLKTFQGPPTGIVVERERL
DKYGRPLLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMHWRDRYLFAM
EAVHRAQAETGEVKGHYLNVTAGTMEDMYERAEFAKELGSCIVMIDLVIGWTAITSMGRW
ARKNDMILHLHRAGHGTYTRQRNHGISFRVIAKWLRMAGVDHAHAGTAVGKLDGDPLSVQ
GYYNVLRESHNSVDLTRGIFFDQHWAGLRKVMPVASGGIHAGQMHQLLDLFGDDAILQFG
GGTIGHPSGIQAGATANRVALETMVKARNEGRDIANEGSDLLEAAARHCTPLKQALDTWG
DVTFNYTPTDSPDFAVTPSVA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatttcagcaaggaagccgtgaagccggccgatagcgccaccgcagccgccaag
gcggaaaagcgctcacgctacgcggcaggcgtgatgaaatatcgcgagatgggctactgg
cagccggactacacgccgaaagacaccgacgtcatcgcgctcttccgcatcacgccgcag
ccaggggtcgaaccggaagaggccgcggccgccgtcgcaggcgaatcgtcgacggcaacg
tggaccgtggtctggaccgatcgtcttaccgcgtgcgacatgtatcgcgcgaaagcgttt
cgcgtcgagcccgtaccgaatccggccgaaggcgagccgcagtacttcgcgttcatcgcc
tacgaactcgacctcttcgaagaagggtcggtggcgaatctcacggcttccatcatcggc
aatgtgttcggcttcaagcctctcaaagcgctgcggctcgaagacatgcgcattcccgtc
gcgtatctgaagacgttccagggcccgccgacaggcatcgtcgtcgaacgcgaacggctc
gacaagtatggccgtccgctgctcggtgcgaccgtcaagccgaagctcgggctgtcggga
aagaactatgggcgcgtcgtgtacgaaggcctcaaaggcggcctcgactttttgaaggac
gatgaaaacatcaattcgcagcccttcatgcactggcgcgaccgctatctgttcgcgatg
gaagcggtgcatcgcgcgcaagccgaaacaggtgaagtgaagggccattacctgaacgtg
acggcgggcacgatggaggacatgtacgagcgcgccgaattcgcgaaagaactgggctcc
tgcatcgtgatgatcgatctcgtgatcggctggaccgcgatcacgtcgatgggacgctgg
gcgcgcaagaacgacatgatcctgcatctgcatcgcgcgggtcacggcacgtacacgcgg
cagcgcaatcacggcatctcgtttcgggtgatcgcaaaatggctgcgcatggcgggcgtc
gatcatgcccatgcgggtacggccgttggcaagctcgacggcgacccgctctccgtgcag
ggctattacaacgtgctgcgcgaatcgcacaactccgtcgatctgacgcgcggcatcttc
ttcgatcagcattgggcaggcttgcgcaaggtgatgcccgtcgcgtcgggcggcattcac
gcggggcagatgcatcagctgctcgacctgttcggcgacgacgcgatcctgcagttcggc
ggcggcacgatcgggcatccgtcgggcatccaggcgggcgcgacggcgaaccgcgtcgca
ctcgagacgatggtcaaggcgcgcaacgaaggccgcgacatcgcgaacgaaggctccgat
ctgctcgaagcggcggcgcgtcattgcacgccgctcaagcaggcgctcgatacatggggc
gacgtcacgttcaactacacgccgaccgattcgcccgatttcgccgtcacgccgagcgtg
gcgtga

DBGET integrated database retrieval system