KEGG   Paraburkholderia phymatum: Bphy_6542Help
Entry
Bphy_6542         CDS       T00704                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bphy_6542
Enzymes [BR:bph01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Bphy_6542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5 Cellulase DUF4434
Motif
Other DBs
NCBI-ProteinID: ACC75570
UniProt: B2JSL7
Position
pBPHY01:complement(1125360..1127258)
Genome map
AA seq 632 aa AA seqDB search
MYMTRHASKQTTGADGLDSPHVFSFAPNGDGFLLDGKPFQIRSGELHPARIPVEYWRHRI
QMAKAMGMNTIALYVMWNYHETREGTFDFQTDNRDIEAFIRLCQAENMWVLFRPGPYVCA
EWDLGGIPSYLLKYADIRLRTDYASDARYMRAVERYIDELVPRVRPLMAQDGGPILMIQI
ENEFGSFDRNRAYLEELRQLWMRGGIPGPFYTEDGVVQLQQNLSYVADGAIALSNANAAQ
IDAVRKIFPSVPAMAGEVYPGWLTHWGDDAFQGTSVDLSATLDELMRNKQSFNLYVIHGG
TSFGFYAGANVDADSGEYQPDITSYDYAAPINEQGAATARYLTYRGIIARYLSAPLPDVP
MPIATIPSMDSNGIRRLMPRRFASLWDNLPAALAPADTMQPQPFEMYGQAFGFVLYRTKL
ERYAGGMLDIGDVHDYATVFVGDQYAGAVSRTRIREQLASPRNVVHRQPVALPDASSAPR
ASVLLEILVEGMGRVNYGHSMIDRKGIVDPVVIHDASGASEIPQGWEVVPLPMETSFIEN
LRPICSDASRPGIFFVATLSIRATGDVYLDMSEWIKGIVWVNGRNLGRYWHVGPQKRLYC
PAPWLKPGDNTLLIFDLHQTDAKPVSLTSSLS
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtacatgacgcgtcacgcatcgaagcaaactacgggtgccgacggactggacagtccg
catgtcttcagcttcgcgccgaacggcgacggcttcctgcttgacggaaagccgtttcag
atccgcagcggagaactgcatcccgcgcggattcccgtcgagtactggcggcaccgcatt
cagatggcaaaagcgatggggatgaacaccatcgcgctatacgtgatgtggaattaccac
gagacgcgcgaggggacattcgactttcagacggacaatcgcgacattgaagccttcata
cgcctttgtcaggcggagaacatgtgggtgctgttcaggccggggccctacgtatgcgcc
gaatgggatctgggcggcattccatcgtatctgctgaaatacgcggatatccggctacgc
acggattacgcgagcgacgcgcgttacatgcgcgctgtcgagcgttacatcgacgaactc
gtgcctcgcgtgcggccgttgatggcacaggacggcggcccgattctgatgatccagatc
gaaaacgaattcggttcgttcgaccgcaatcgcgcctatctggaggaactgaggcagttg
tggatgcgcggcggcattcccggtccgttctatacggaagacggcgtcgtgcaactccaa
cagaatctgtcatatgtggcggacggtgcgattgctctgagcaacgccaacgccgcgcag
atcgacgcggtgcgcaagatctttccttccgtgcccgcaatggcgggcgaggtctatccg
ggatggctcacgcattggggcgacgacgcattccagggcacatccgtcgatctttccgcc
acgctcgatgagttgatgcgcaacaaacagtcattcaatctgtatgtgattcatggcggc
acgagctttggcttttacgctggcgcgaacgtggatgcggactcgggcgagtatcagccc
gacatcacgagttacgactatgctgcgcccatcaatgagcagggtgcagcgaccgcacgc
tacctgacataccgcggcatcatcgcgcggtatctttctgcaccattgcccgatgtgccc
atgcccatcgcaacgattccctcgatggactcaaacggcattcggcggttgatgccgcga
cgatttgcgtcgctctgggacaatcttcccgctgcgcttgcgcccgcagacacgatgcag
ccgcagcccttcgagatgtacggccaggcattcggcttcgtgctgtatcggacgaaactg
gagcgctacgcgggcggcatgctggacatcggcgatgttcacgattacgcgaccgttttc
gtcggcgatcagtatgcgggcgcagtgtcgcgcacgcgcatacgagagcagttggcttcg
ccacggaacgtcgtgcatcgacagccggttgcgttgcccgatgcgtcgtctgccccgcgc
gccagcgtattgctggagattctcgtcgaaggcatgggccgcgtgaattacgggcattcg
atgatcgatcgcaagggcatagtcgaccccgtcgtcattcacgatgcgtcgggcgcaagc
gaaattccacagggctgggaagtcgtgccgttgccgatggagacttcgtttatcgagaac
ctgcgtccgatctgttccgacgccagcaggccgggcatcttcttcgtggcgacgctatcg
atccgtgccaccggcgatgtctatctggacatgagcgaatggatcaaaggcatcgtatgg
gtcaatggccgcaatctcgggcgttactggcatgtcggtccgcagaagcggctctattgc
ccggcgccgtggttgaagccaggtgacaacaccctattgatcttcgatttgcatcagacc
gacgcgaagcctgtgagcctcacgtcgtcactttcatag

DBGET integrated database retrieval system