KEGG   Blattabacterium BPLAN (Periplaneta americana): BPLAN_537Help
Entry
BPLAN_537         CDS       T00996                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acyltransferase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bpi  Blattabacterium BPLAN (Periplaneta americana)
Pathway
bpi00010  Glycolysis / Gluconeogenesis
bpi00020  Citrate cycle (TCA cycle)
bpi00620  Pyruvate metabolism
bpi01100  Metabolic pathways
bpi01110  Biosynthesis of secondary metabolites
bpi01120  Microbial metabolism in diverse environments
bpi01130  Biosynthesis of antibiotics
bpi01200  Carbon metabolism
Module
bpi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPLAN_537 (aceF)
   00020 Citrate cycle (TCA cycle)
    BPLAN_537 (aceF)
   00620 Pyruvate metabolism
    BPLAN_537 (aceF)
Enzymes [BR:bpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BPLAN_537 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT PYNP_C DUF2118 DUF4258
Motif
Other DBs
NCBI-ProteinID: ACX84141
UniProt: D0J9X0
Position
554411..555604
Genome map
AA seq 397 aa AA seqDB search
MAEIISMPQLSDTMEEGTVIKWNKKVGDKVSEGDILAEIETDKATQDFEIDVSGILLFIG
VEEGKKTRVNDILAIIGEEGEDISHLIKNSKEKKEKIKEKKVEKILSNENRKKNKDRIFI
SPLAKRMAKEVGISIRKIKGSGDHGRIIKRDIETYEKTLDDNRRIVCEQMDDKRVIISSM
RKKIAEHLTHSKFTAPHYYLIIEIDVGKMIQLRKNLNEKLSTEEKISFNDIIIKAVAISL
KKNPNVNTSWKEKEIIYHSFINIGVAVAVKEGLIVPVIHNADKKSLLQISKEIKDKALRS
KSRKIKPEEIENSTFTVSNLGMYGIEFFTSIINIPNSSILSIGTITEKPIVKNSEISIGY
VMKVTLSCDHRIIDGSTGSNFLKHLKNLLEDPILILV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaataatatccatgccccaattgagtgatacaatggaagaggggactgtaatt
aaatggaataaaaaagtaggagacaaagtttccgaaggagatattttagcagaaattgaa
acggataaagctactcaagattttgaaattgatgttagtggaattcttctttttattggc
gtagaagaagggaaaaaaacacgagtcaatgatatattagccatcattggtgaagaagga
gaagatattagccatcttattaaaaattcaaaagaaaaaaaagaaaaaataaaggagaaa
aaggtagaaaaaatactttctaatgagaatagaaaaaagaataaagacaggatatttatc
tctcctttagcaaaaaggatggccaaagaagtagggatttctatcagaaagataaaagga
agtggagatcacggtcgtatcattaaaagagatattgaaacatacgaaaaaacattagat
gataatagaagaatagtctgtgaacaaatggatgataaacgggtcattatttcttctatg
agaaaaaaaatagctgaacatttaactcattctaaatttacagctcctcactattatctc
attattgaaattgatgtaggaaaaatgatacaattaagaaaaaatttaaatgaaaaactc
tctaccgaagaaaaaatttcttttaatgatattattattaaagcagttgcaatttctttg
aaaaagaatcctaatgtaaatacttcatggaaagaaaaagaaataatctatcattctttc
attaatattggagtggcagtagcagtaaaagaagggttaattgttccagtgatccacaat
gcggataaaaaatcattactacaaatatccaaagaaatcaaagataaagctttacgttca
aagtctagaaaaataaagcctgaagagatagaaaatagtacgtttacagtttcaaatcta
ggaatgtacggaatagaattttttacttctattattaatattcctaattcttctattctt
tctataggaaccattacagaaaaacctattgtaaagaattccgaaatttcaatcggatat
gtcatgaaagtaactttatcttgtgatcacagaataatagatggatctacaggaagtaat
tttcttaagcatttaaaaaacctgttagaagatccaatcctcatattagtttaa

DBGET integrated database retrieval system