KEGG   Brachyspira pilosicoli P43/6/78: BPP43_01805Help
Entry
BPP43_01805       CDS       T02387                                 

Definition
(GenBank) alpha-galactosidase/6-phospho-beta-glucosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
bpip00052  Galactose metabolism
bpip00561  Glycerolipid metabolism
bpip00600  Sphingolipid metabolism
bpip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpip00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BPP43_01805
  Lipid metabolism
   00561 Glycerolipid metabolism
    BPP43_01805
   00600 Sphingolipid metabolism
    BPP43_01805
Enzymes [BR:bpip01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BPP43_01805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C
Motif
Other DBs
NCBI-ProteinID: AGA65693
Position
complement(380177..381532)
Genome map
AA seq 451 aa AA seqDB search
MKFVLVGAGSAQFGCDMLGDIFSTKSLEGSHITLLDINNNALKKVYDYVREFIEANKLNF
SVDATTERKEAFKNTDFIISSIEVGDRFQLWDEDWKIPMQYGIHQVYGENGGAGGVFHSL
RIIPPILDIVKDAMDICPNAYIFNFSNPMTAICTAVKRAYPNAKFIGMCHEIGWLHKWLP
KILKKNYEDFEIKAGGLNHFSCLLEIKDKKTGKDLYPDVLKNAHSYFEHEVGYSDLLKYA
KANNAFSKTESFDHSIEEKLKGEFIWADRRLLKVILEQYKLLPITVDSHFGEYIAWAWDV
VDHRGILDFYELYRTVLSKAEPKIELRVKERASSIIDGIVTNNKYTEEAVNILNDGLIED
LPNWIAVEVPAEISKDGVKGVKLNNISKGFLSLLRNYVSVYDLTAEAAIHHKKEYAVQAI
LANPVVNVCKNTEEMLDRMIDNQKPYLDYLK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgttttagttggtgcaggaagtgcacaatttggatgcgatatgcttggagac
attttctccacaaaatcattagaaggctctcatataactttgcttgatattaacaataac
gccttaaaaaaggtatatgattatgtaagagagtttattgaggctaacaaattgaatttt
agtgttgatgctactacagagagaaaagaggcatttaagaacactgatttcattataagc
tctatagaagtgggagatagatttcaattatgggacgaagattggaaaatacctatgcaa
tatggaatacatcaagtttatggagaaaatggaggagctggaggagtatttcactctttg
agaattattccgcctattttggatatagtaaaagatgctatggacatatgtcctaatgct
tatatatttaatttttcaaaccctatgactgcaatatgtactgctgtaaaaagggcttat
cctaatgcaaaatttataggcatgtgccatgagataggctggcttcataaatggcttcca
aaaatactaaaaaagaattatgaggattttgaaataaaagctggcgggcttaaccatttc
agctgtttattagagataaaagataaaaagacaggaaaagatttgtatcctgatgtatta
aaaaacgctcatagttattttgagcatgaagtaggctatagtgatttactaaaatacgct
aaagcaaataatgcattttctaaaacagagagttttgaccattctatagaagagaaattg
aaaggtgagtttatatgggctgacagaagattattaaaagtgatattagaacaatataaa
ttattacctataacagttgatagtcattttggagaatatatagcttgggcttgggacgtt
gttgatcatagaggtatattagacttttatgaattatacagaacagttctttcaaaggct
gagcctaaaatagaattaagagtaaaagagagagcttcaagcataatagatggtatagtt
acaaacaataaatacacagaagaagctgtaaatattttgaatgacggattaatagaagat
ttgcctaattggatagcagttgaagtacctgctgaaataagcaaagatggagttaagggc
gttaaattaaacaatatatctaaaggatttttatctcttctaagaaactatgtgagtgta
tatgatttaactgctgaggctgctatacatcataaaaaagaatatgcagtgcaggctata
cttgctaatcctgtagttaatgtatgtaaaaatacagaggaaatgctagatagaatgata
gataatcaaaagccatatttagattatttaaaataa

DBGET integrated database retrieval system