KEGG   Brachyspira pilosicoli P43/6/78: BPP43_03685Help
Entry
BPP43_03685       CDS       T02387                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
bpip00561  Glycerolipid metabolism
bpip00640  Propanoate metabolism
bpip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BPP43_03685
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BPP43_03685
Enzymes [BR:bpip01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     BPP43_03685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AGA66029
UniProt: A0A3B6VU64
Position
complement(783038..784126)
Genome map
AA seq 362 aa AA seqDB search
MESLFLPNYTIGSDAYNYIDDICKNYGSNAVIISGKKSLNASRDILLKSLKNINVTAEIY
YGGVASYENVEMLKNIKEIKEADMVFAVGGGRCVDTVKTLCDMINKPLFTFPTLASNCAA
VTSLSVMYNSDDSYKNLYTQKRPAIHTFINTDIILNSPERYFIAGMGDALSKQYETLFST
RNEVFDYKNFLGYEIIKECSNDIIKYSLKAFNDFKNKKPTDDFNRVVLHIVYTTGLTSVT
MRDDYHISLPHAVYNGLTRIKEIGEKYFHGELVAYGILLLLTMDKKFDELEKVFNFNKSL
SLPTSIKAIGIKDISLENEELSKVLEGAYVSKDLEVSPYPITKDMIINAMLELEEYNIKK
AL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtttatttttaccaaattatactattggaagtgatgcatataattatatagat
gatatatgtaaaaattatggctctaatgctgttattatttctggaaaaaaatctttaaat
gcttcaagagatattttattaaagagcttaaaaaatataaatgtaactgctgaaatttat
tatggcggtgttgctagttatgagaatgttgagatgctcaaaaatattaaagagataaaa
gaagcggatatggtttttgctgttggaggcggtcgctgtgttgatacagtaaaaacactt
tgcgatatgataaataagcctttatttacatttcctacattagcttctaattgtgcagct
gttacaagtttgtctgttatgtataatagcgatgattcttataagaacttatatactcaa
aaaagacctgctattcacacttttattaatactgatattatattaaactctcctgagaga
tattttattgcaggcatgggagatgctttatctaagcaatatgaaactttattttctaca
agaaatgaagtttttgattataaaaattttttaggctatgaaataataaaagaatgttct
aatgatataataaaatattctttaaaagcttttaatgattttaaaaacaaaaagcctact
gatgattttaatagagtagttttgcatatagtgtatactacaggacttacatctgttact
atgagagatgattatcatatatcattgcctcatgctgtgtataatggacttacaagaata
aaggagataggggagaagtattttcatggagagcttgtcgcttatggtatacttttgctt
ttaactatggataaaaaatttgatgaacttgaaaaagtttttaattttaataaatcttta
tctcttccaacttcaataaaggcaataggtataaaagatataagtttagaaaatgaagag
ttatcaaaagttttagaaggggcatatgtttcaaaagatttggaggtttctccttatcct
attactaaagatatgataattaatgctatgctagagcttgaagagtataatataaaaaaa
gcattataa

DBGET integrated database retrieval system