KEGG   Brachyspira pilosicoli P43/6/78: BPP43_04775Help
Entry
BPP43_04775       CDS       T02387                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
bpip00480  Glutathione metabolism
bpip00590  Arachidonic acid metabolism
bpip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpip00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BPP43_04775
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BPP43_04775
Enzymes [BR:bpip01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BPP43_04775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-ProteinID: AGA66227
UniProt: A0A3B6VYQ1
Position
complement(1000362..1000715)
Genome map
AA seq 117 aa AA seqDB search
MQDLYKKYKKDGFEILDFPCNQFGGQAKEPIEEIAEFRKEKYGVTFKLFDKVKVNSKNAD
PLFTYLRTEKPTEEGVDKIRWNFGKFLIDRQGNIVGRYDPRVKPEELDEIVSELLKK
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggatttatacaaaaaatataaaaaagatggttttgaaatattagacttcccttgt
aatcaattcggcggacaggcaaaagagcctattgaagaaattgctgagtttagaaaagaa
aaatacggcgttacttttaagttatttgataaagtaaaagttaatagcaaaaatgctgac
cctttatttacttatttaagaaccgaaaaaccaactgaagagggtgttgataaaataaga
tggaattttggtaaatttttaatagataggcaaggcaatatagtagggcgttatgaccct
agggtaaaacctgaagaacttgatgagatagtatcagagttattaaaaaaataa

DBGET integrated database retrieval system