KEGG   Brachyspira pilosicoli P43/6/78: BPP43_08555Help
Entry
BPP43_08555       CDS       T02387                                 

Definition
(GenBank) selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
bpip  Brachyspira pilosicoli P43/6/78
Pathway
bpip00450  Selenocompound metabolism
bpip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpip00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BPP43_08555
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bpip03016]
    BPP43_08555
Enzymes [BR:bpip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     BPP43_08555
Transfer RNA biogenesis [BR:bpip03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BPP43_08555
 Prokaryotic Type
    BPP43_08555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS Phosphatase PDH
Motif
Other DBs
NCBI-ProteinID: AGA66904
UniProt: A0A3B6VPF7
Position
complement(1793868..1794932)
Genome map
AA seq 354 aa AA seqDB search
MEDIKKEEEKIELLSCALEGGCSAKIPPDLLEKTLSPILKTKVDSNLLSDVDIGDDAGVY
KISEDNAIIFTVDFFPPVVADPYLFGEIAACNSISDIYAMGGEPKLALNITMYPKENSLN
TLATILKGGQDKATEAGVLVVGGHTITDTAIKYGMAVIGFANPNNITTNSAAKDGDIIIL
TKPLGTGACLAAMRQGLIKESAITDVFNAMSTLNKKACAVMNKYNAKCATDVTGFGLAGH
AYKMAKASDVTIEINTSALPMFEKSYEVLDIGCIPGAAFTNMRYVGENILVDENVDYSLK
MLTFDPQTAGGLFICVDKANAENMLADLWREGIDCAAIVGRVTKKNREYIHLTK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggaagatattaaaaaagaagaagagaaaattgagttattatcttgtgctttagagggc
ggctgttctgccaaaattccgcctgatttgcttgaaaagacattatcgcctatattaaaa
acaaaagtagattctaatctattatctgatgttgatataggagatgatgctggagtttat
aagatttcagaggataatgctattatatttacagtagatttttttcctcctgttgttgca
gacccttatttatttggagagattgctgcttgtaactctataagcgatatatatgctatg
ggaggagagccaaaattagctttaaatattacaatgtatccaaaagaaaactctcttaat
actcttgctacaatattaaaaggcggacaagacaaagctacagaagcaggcgtattggtt
gtaggagggcatactatcacagatacagcaattaaatatggtatggctgttattggtttt
gctaatcctaataatattactacaaactctgctgctaaagacggagatattataatactt
acaaagcctcttggtacaggtgcttgtttagctgctatgaggcagggattaataaaagaa
agtgctattacagatgtatttaatgctatgagtactttaaataaaaaagcttgtgctgta
atgaataaatataatgcaaaatgtgctacagatgtaacaggtttcggacttgctggtcat
gcttacaagatggctaaggctagtgatgtaactatagagataaatacatcagcattgcct
atgtttgagaagagttatgaggtattggatattggctgtatacctggggctgcttttaca
aatatgcgttatgttggtgagaatattttagttgatgagaatgtggattatagcttaaag
atgcttacttttgaccctcagactgctggcggattatttatatgtgtagataaggctaat
gctgagaatatgcttgctgatttatggcgtgagggcattgattgtgcggctattgttgga
agggtaactaaaaagaatagagaatatatacaccttactaaataa

DBGET integrated database retrieval system