KEGG   Brachyspira pilosicoli B2904: B2904_orf2446Help
Entry
B2904_orf2446     CDS       T02225                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
bpj00051  Fructose and mannose metabolism
bpj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    B2904_orf2446 (mtlD)
Enzymes [BR:bpj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     B2904_orf2446 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh ApbA
Motif
Other DBs
NCBI-ProteinID: AFR71772
UniProt: J9U257
Position
complement(2514255..2515409)
Genome map
AA seq 384 aa AA seqDB search
MKKMIQIGAGNIGRACVGRLFHEAGYEVYFSDVNTELLSLISNNKHYNIRMVGKDVDKTI
KIDNVDKVPEDEESLLKLFDDIEIITTAVGVNILPKIAPFIAKAINRRFDLKNDKPLNVI
ACENTTGASSKLKESVYALLNDDVKRCMHGIVAFPNVAVDCIVPTIKNEDPLTVTCENFA
DLIIDRSVFIGDLPQVEGLSLKENLDAYVERKLFTLNTGHAITAYLGFLNDKKTIYDAIN
DESIKNIVLGAMRESGAVLIKRHGFKEDEHEAYIQKILSRFFNPYLEDSVLRVGREPMRK
LSYNDRLIKPILGTLEYNLKHDNLVKGVAAAFQFYSEDDSESKELKKMLYSESLSDVVMK
VTGLKNEKALFDEIYNELNKVLKK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgattcaaataggtgcaggaaatataggaagagcttgcgttggaagatta
ttccatgaagctggatatgaagtatatttttctgatgtaaatactgaactattatcatta
atatcaaacaataaacattataatataagaatggttggaaaggatgttgataagactata
aaaatagataatgttgataaagtacctgaagacgaagagagtttattaaaattatttgat
gatatagaaattataactactgctgtcggagttaatatacttcctaaaatagcacctttt
atagctaaagctattaatagaagatttgatttaaaaaatgataagccattaaatgttata
gcatgtgaaaatactactggtgcttcttctaaacttaaagaaagtgtttatgctcttttg
aatgacgatgttaaaagatgtatgcatggtatagttgcttttcctaatgttgctgttgat
tgtattgtacctactataaaaaatgaagatcctcttactgttacttgcgagaattttgct
gatcttataatagacagatctgttttcattggagatttgcctcaagttgaaggattatct
ttaaaagaaaatttagatgcttatgttgaaagaaaattattcactttaaatactggacat
gccataactgcatatttaggatttctaaacgataaaaaaactatatatgatgctataaat
gatgaaagcattaaaaatatagtattaggtgctatgagagaaagcggtgctgttttgata
aaaagacatggatttaaagaagatgaacatgaagcttatatacaaaaaatattaagcaga
tttttcaacccttatttagaagattctgttttaagagttggaagagagcctatgcgtaaa
ttatcatataatgacagattaataaaacctatattgggaactttagaatataatttaaaa
catgataatttagttaagggtgttgcagctgctttccaattctatagtgaagatgacagt
gaaagtaaagaacttaaaaaaatgctttatagtgaaagtttatcagatgtagttatgaaa
gtaactggattaaaaaatgaaaaagcattattcgacgaaatatacaatgaattaaataaa
gtattaaaaaaataa

DBGET integrated database retrieval system