KEGG   Burkholderia pseudomallei NCTC 13179: BBK_1093Help
Entry
BBK_1093          CDS       T02894                                 

Definition
(GenBank) acCoA-C-Actrans: acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Pathway
bpk00071  Fatty acid degradation
bpk00072  Synthesis and degradation of ketone bodies
bpk00280  Valine, leucine and isoleucine degradation
bpk00310  Lysine degradation
bpk00362  Benzoate degradation
bpk00380  Tryptophan metabolism
bpk00620  Pyruvate metabolism
bpk00630  Glyoxylate and dicarboxylate metabolism
bpk00640  Propanoate metabolism
bpk00650  Butanoate metabolism
bpk00900  Terpenoid backbone biosynthesis
bpk01100  Metabolic pathways
bpk01110  Biosynthesis of secondary metabolites
bpk01120  Microbial metabolism in diverse environments
bpk01130  Biosynthesis of antibiotics
bpk01200  Carbon metabolism
bpk01212  Fatty acid metabolism
bpk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBK_1093
   00630 Glyoxylate and dicarboxylate metabolism
    BBK_1093
   00640 Propanoate metabolism
    BBK_1093
   00650 Butanoate metabolism
    BBK_1093
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBK_1093
   00072 Synthesis and degradation of ketone bodies
    BBK_1093
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBK_1093
   00310 Lysine degradation
    BBK_1093
   00380 Tryptophan metabolism
    BBK_1093
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBK_1093
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBK_1093
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BBK_1093
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpk04147]
    BBK_1093
Enzymes [BR:bpk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BBK_1093
Exosome [BR:bpk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBK_1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGZ26758
Position
1:1313173..1314366
Genome map
AA seq 397 aa AA seqDB search
MTAVDQDPIVIASAARTPIAGFQGEFASLAAPQLGAAAIAAALERAGLQPEQIDEAVMGC
VLPAGQGQAPARQAALGAKLPLSVGCTTINKMCGSGMRAAMFAHDMLVAGSVDVIVAGGM
ESMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEECAGEYAFSRDA
QDAFAIESLARAKRANEDGSFAWEIAPVTVAGKKGDAVIARDEQPFKANPEKIPTLKPAF
SKTGTVTAANSSSISDGAAALVMMRASTANRLGLAPLARVVGHSTFAQAPSKFTTAPVGA
IRRLFEKNGWRAAEVDLYEINEAFAVVTMAAMKEHGLPHEKVNVNGGACALGHPIGASGA
RILVTLIGALRARGAKRGVASLCIGGGEATAMGIELI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacggctgttgatcaggatccgatcgtcatcgcatcggcggcgcgcacgccgatcgcg
ggctttcagggcgagttcgcgtcgctcgccgcgccgcagctgggcgcggccgcgatcgcc
gcggcgctcgagcgcgcgggcctgcaaccggagcagatcgacgaggcggtgatgggctgc
gtgctgcccgccgggcaggggcaggcgccggcacggcaggcggcgctcggcgcgaagctg
ccgctgtcggtcggctgcacgacgatcaacaagatgtgcggctcgggcatgcgcgcggcg
atgttcgcgcacgacatgctcgtggcgggctccgtcgacgtgatcgtcgcgggcggcatg
gaaagcatgacgaacgcgccgtacctgctgccgaaggcgcgcgccggcatgcgcatgggc
cacggccaggtgctcgaccacatgttcctcgacggcctcgaggacgcctacgacaagggc
cggctgatgggcacgttcgccgaggaatgcgcgggcgaatacgcgttctcgcgcgacgcg
caggacgcgttcgcgatcgaatcgctcgcgcgcgcgaagcgggcgaacgaggacggctcg
ttcgcgtgggaaatcgcgcccgtgacggtggccggcaagaagggcgatgcggtgatcgcg
cgcgacgagcagccgttcaaggcgaaccccgagaagattccgacgctcaagcccgcgttc
agcaagacgggcaccgtgaccgccgcgaattcgtcgtcgatctccgacggcgcggccgcg
ctcgtgatgatgcgcgcgtcgacggcgaaccggctcgggctcgcgccgctcgcgcgcgtc
gtcggccattcgacgttcgcgcaggcgccgtcgaagttcacgacggcgcctgtcggcgcg
atccggcgcctgttcgagaagaacggctggcgcgcggccgaggtcgatctgtacgagatc
aacgaagcgttcgcggtcgtcacgatggcggcgatgaaggagcacggcctgccgcacgag
aaggtcaacgtgaacggcggcgcgtgcgcgctcggccatccgatcggcgcgtcgggcgcc
cgcatcctcgtcacgctgatcggtgcgctgcgcgcgcgcggggccaagcgcggcgtggcg
agcctgtgcatcggcggcggcgaggcgaccgcgatgggcatcgagctgatctga

DBGET integrated database retrieval system