KEGG   Burkholderia pseudomallei NCTC 13179: BBK_2437Help
Entry
BBK_2437          CDS       T02894                                 

Gene name
rfaD
Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Pathway
bpk00540  Lipopolysaccharide biosynthesis
bpk01100  Metabolic pathways
Module
bpk_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:bpk00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BBK_2437 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bpk01005]
    BBK_2437 (rfaD)
Enzymes [BR:bpk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     BBK_2437 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:bpk01005]
 Unusual sugar
  BBK_2437 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 NAD_binding_4 NAD_binding_10 KR
Motif
Other DBs
NCBI-ProteinID: AGZ28312
Position
1:2792991..2793983
Genome map
AA seq 330 aa AA seqDB search
MTLIVTGAAGFIGANIVKALNERGETRIIAVDNLTRADKFKNLVDCEIDDYLDKTEFVER
FARGDFGKVRAVFHEGACSDTMETDGRYMMDNNFRYSRAVLDACLAQGTQFLYASSAAIY
GGSSRFVEAREFEAPLNVYGYSKFLFDQVIRRVMPSAKSQIAGFRYFNVYGPRESHKGRM
ASVAFHNFNQFRAEGKVKLFGEYNGYGPGEQTRDFVSVEDVAKVNLHFFDHPQKSGIFNL
GTGRAQPFNDIATTVVNTLRALEGQPALTLAEQVEQGFVKYVPFPDALRGKYQCFTQADQ
TTLRAAGYDAPFLTVQEGVDRYVRWLFGQL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcatcgttaccggcgcggccggcttcatcggcgcgaacatcgtcaaggcgctg
aacgagcgcggcgagacgcgcatcatcgcggtcgacaacctgacgcgcgcggacaagttc
aagaatctcgtcgattgcgagatcgacgactatctcgacaagaccgagttcgtcgagcgc
ttcgcgcgcggcgatttcggcaaggtgcgcgcggtgtttcatgaaggcgcctgctcggac
acgatggaaaccgacggccgctacatgatggacaacaacttccgctacagccgcgcggtg
ctcgacgcgtgcctcgcgcagggcacgcagttcctgtatgcgtcgtcggccgcgatctac
ggcggctcgagccgcttcgtcgaggcgcgcgagttcgaggcgccgctcaatgtgtacggc
tattcgaagttcctgttcgatcaggtgatccgccgcgtgatgccgagcgcgaagagccag
atcgcgggcttccgctatttcaacgtgtacgggccgcgcgagtcgcacaaggggcgcatg
gcgtcggttgcgttccacaacttcaaccagtttcgcgccgagggcaaggtcaagctcttc
ggcgagtacaacggctatggcccgggcgagcagacgcgcgatttcgtgtcggtcgaggac
gtcgcgaaggtgaacctgcatttcttcgatcacccgcagaagtcgggcatcttcaatctc
ggtaccggccgcgcgcagccgttcaacgacatcgcgacgacggtcgtcaacacgctgcgc
gcgctcgaaggccagcccgcgctcacgcttgccgagcaggtcgagcaggggttcgtcaaa
tacgtgccgttcccggacgcgctgcgcggcaagtaccagtgcttcacgcaagccgatcag
acgacgctgcgcgcggccggctacgacgcgccgttcctgacggtgcaggaaggcgtcgat
cgctacgttcgttggctgttcggccagctgtaa

DBGET integrated database retrieval system