KEGG   Burkholderia pseudomallei NCTC 13179: BBK_2973Help
Entry
BBK_2973          CDS       T02894                                 

Definition
(GenBank) aminotransferase class-V family protein
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Pathway
bpk00220  Arginine biosynthesis
bpk00250  Alanine, aspartate and glutamate metabolism
bpk00290  Valine, leucine and isoleucine biosynthesis
bpk01100  Metabolic pathways
bpk01110  Biosynthesis of secondary metabolites
bpk01130  Biosynthesis of antibiotics
bpk01210  2-Oxocarboxylic acid metabolism
bpk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpk00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BBK_2973
   00290 Valine, leucine and isoleucine biosynthesis
    BBK_2973
   00220 Arginine biosynthesis
    BBK_2973
Enzymes [BR:bpk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BBK_2973
    2.6.1.66  valine---pyruvate transaminase
     BBK_2973
Amino acid related enzymes [BR:bpk01007]
 Aminotransferase (transaminase)
  Class I
   BBK_2973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Alliinase_C Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGZ28607
Position
1:3408671..3409909
Genome map
AA seq 412 aa AA seqDB search
MKPIQKSNKLLNVCYDIRGPVLEHAKRLEDEGHRIIKLNIGNLAPFGFDAPDEIIQDMIR
NLPASSGYSDSKGVFAARKAIMHYTQQKGVHGVGLDDIYIGNGASELIVMATQALLNDGD
EVLLPAPDYPLWTAAVSLSGGTPVHYVCDESNRWMPDPDDIRRKITPNTKALVVINPNNP
TGALYSDALLVELIAIAREHGLIIFADEVYDKIVYDGKSHTALASLAEDVITVTFNSLSK
SYRSCGYRAGWMSVAGLTAENRRRAHDYLEGLGILSSMRLCANVPGQYAIQTALGGYQSI
NELIMPSGRLYKQRELAYDMLTSIPGVSCVKPEAALYMFPRLDPKLYPIENDQQFILELL
LRERVLLVQGTGFNWPTPDHFRVVFLPNVDDLTDSIERIARFLDGYRKRNSV
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccgattcagaagtcgaacaagctgctcaatgtctgctacgacatccgcggcccc
gtcctcgagcacgcgaagcgcctcgaggacgaggggcatcgcatcatcaagctgaacatc
ggcaacctggcgccgttcggtttcgacgcgccggacgagatcatccaggacatgatccgc
aacctgccggcgtcctccggctattcggattcgaaaggcgtgttcgccgcgcgcaaggcg
atcatgcactacacgcagcaaaagggcgtgcacggcgtcgggctcgacgacatctacatc
ggcaacggcgcgtccgagctcatcgtgatggcgacgcaggcgttgctgaacgacggcgac
gaggtgctgctgcccgcgcccgactatccgctctggacggcggccgtgagcctgtcgggc
ggcacgcccgtgcactacgtctgcgacgagtcgaaccgctggatgcccgaccccgacgac
atccgccgcaagatcacgccgaacacgaaggcgctcgtcgtgatcaacccgaacaacccg
acgggcgcgctttattccgacgcattgctcgtcgagttgatcgcgatcgcgcgcgagcac
gggctcatcatcttcgccgacgaggtctacgacaagatcgtctacgacggcaagtcgcac
accgcgctcgcgtcgctcgccgaggacgtgatcaccgtcacgttcaacagcctgtcgaag
agctaccggtcgtgcggctatcgcgcgggctggatgtcggtcgcggggctcacggccgag
aaccgccgccgcgcgcacgattacctggaggggctcggcatcctgtcgtcgatgcgcctt
tgcgcgaacgtacccggccagtacgcgatccagaccgcgctcggcggctatcagagcatc
aacgagctgatcatgccgagcgggcgcctgtacaagcagcgcgagctcgcgtacgacatg
ctgacgtcgattcccggcgtgtcgtgcgtgaagccggaagcggcgctctacatgtttccg
cgcctcgatccgaagctctacccgatcgagaacgaccagcagttcatcctcgagctgctg
ctgcgggagcgcgtgctgctcgtgcagggcacgggcttcaactggccgacgccggaccac
ttccgcgtcgtgttcctgccgaacgtcgacgacctgaccgattcgatcgagcggatcgca
cgctttctcgacggctaccggaagcgcaactcggtctga

DBGET integrated database retrieval system