KEGG   Burkholderia pseudomallei NCTC 13179: BBK_351Help
Entry
BBK_351           CDS       T02894                                 

Definition
(GenBank) amidase family protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Pathway
bpk00330  Arginine and proline metabolism
bpk00360  Phenylalanine metabolism
bpk00380  Tryptophan metabolism
bpk00627  Aminobenzoate degradation
bpk00643  Styrene degradation
bpk01100  Metabolic pathways
bpk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BBK_351
   00360 Phenylalanine metabolism
    BBK_351
   00380 Tryptophan metabolism
    BBK_351
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BBK_351
   00643 Styrene degradation
    BBK_351
Enzymes [BR:bpk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BBK_351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase 2_5_RNA_ligase2
Motif
Other DBs
NCBI-ProteinID: AGZ27230
Position
1:complement(431731..433125)
Genome map
AA seq 464 aa AA seqDB search
MSELLDLSACSLAERFKNRSVTPVDYAHALLDHIARWEPHLNALCRFDPARVRDEALAST
RRWAAGAPLSEIDGVPVTIKELIATQGDRVAQGSAAAADAPPATVDAPAAARLREAGAVV
IGKTTVPDYAMLSSGLSSLYGITRNPWRLDLNPGGSSSGAAAAAAAGYGPLHVGTDIGGS
IRLPAGWCGIVGFKPSNGRIPIEPYYTGRCAGPMTRTIDDAALLMRFLSRPDWRDATSLP
PETIDWSIAPAHVKGMRIGLMLDAGCGLAPDPQIVAAVEAAAERFAAHGARIVAAPPVLS
RPMLEGLDRFWRARLWADLERLPDAARARILPYIVEWAGQGASVSGVEAVRGFGATFQMR
AAAARLFQSVDAVLSPTNVVTGFPAEWAGPTDDPARPFEHIAFTVPWNMGEQPALSINCG
FARDGMPIGLQIVGPRFADRLVLQLGRAYEAWRGEMPRWPAPPR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagttgctcgacctgagcgcttgctcgcttgccgagcggttcaagaaccgcagc
gtgacgcccgtcgattacgcgcacgcgctgctcgaccacattgcccgttgggagccgcat
ctgaatgcgctgtgccgcttcgatccggcgcgcgtgcgtgacgaggcgctcgcgtcgacg
cgccgctgggcggcgggcgcgccgctcagcgagatcgacggcgtgccggtgacgatcaag
gaactgatcgcgacgcagggcgaccgggtggcgcaaggctcggcggccgccgccgacgcg
ccgcccgcgaccgtcgacgcgcccgccgcggcgcggctgcgcgaagcgggcgcggtcgtg
atcggcaagacgacggtgcccgattacgcgatgctgtcgtcggggctgtcgagcctgtac
ggcatcacgcgcaacccgtggcggctcgatctgaatccgggcggatcgagcagcggcgcg
gcggcggccgccgccgcgggctacgggccgctgcacgtcggcaccgacatcggcgggtcg
atccggctgccggccggctggtgcgggatcgtcggcttcaagccgtcgaacgggcggatt
ccgatcgagccgtactacacgggccgctgcgcggggccgatgacgcgcacgatcgacgat
gcggcgctgctgatgcgcttcctgtcgcggccggactggcgcgacgcgacgagcctgccg
cccgagacgatcgactggtcgatcgcgcccgcgcacgtcaagggcatgcggatcggcctg
atgctcgacgccggctgcggactcgcgccggatccgcagatcgtcgccgcggtggaggcg
gcggccgagcgtttcgccgcgcacggcgcgcggatcgtcgccgcgccgcccgtgctgtcg
cggccgatgctcgaggggctcgaccgcttctggcgggcgcggctatgggcggacctcgaa
cggctgccggacgcggcgcgcgcgcgcatcctgccgtacatcgtcgaatgggcggggcag
ggcgcgtcggtgtcgggcgtcgaggcggtgcgcggcttcggcgcgacgttccagatgcgc
gcggccgccgcacgcctgttccagtcggtcgacgcggtgctgtcgccgaccaacgtcgtc
accggctttccggccgaatgggcggggccgaccgatgatcctgcgcggccgttcgagcac
atcgcgttcacggttccgtggaacatgggcgagcagccggcgctgtcgatcaactgcggc
ttcgcgcgcgacgggatgccaatcggcctgcagatcgtcgggccgcgttttgccgatcgg
ctcgtgctgcagctcggtcgcgcgtacgaggcctggcgcggcgagatgccccgctggccg
gcgccgccgcgctga

DBGET integrated database retrieval system