KEGG   Burkholderia pseudomallei NCTC 13179: BBK_3665Help
Entry
BBK_3665          CDS       T02894                                 

Definition
(GenBank) SMP-30/Gluconolaconase/LRE-like region family protein
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Pathway
bpk00053  Ascorbate and aldarate metabolism
bpk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BBK_3665
Enzymes [BR:bpk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     BBK_3665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL PD40 Str_synth
Motif
Other DBs
NCBI-ProteinID: AGZ30767
Position
2:complement(254048..254983)
Genome map
AA seq 311 aa AA seqDB search
MESSNRPARTHEASAATLLVDCRNALGEGATWCDAAHALYWVDIEGARLWRWRAAGAHGG
ERCDSWEMPERIACFALTGDPDVLLVGLASRLAFFDTRRRALTPIVDVEPDRPTRLNDGR
CDRAGAFVFGTKDESGGASPRAIGGYYRLNADLSLQRLALPPAAIANGIAFSPDGSAMYF
CDSPTREIQVCDYRPGGDVDRVRSFVRLADEHGEPDGSTVDASGGVWNAQWGGARVVRYD
AQGVETDRIAVPTPQPSCVTLDAAGRLYVTSARVGLDDGALAGNPGAGGVFVAHTRHPGG
ATPRFALARHA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggaatcatcgaatcgaccggcgcgaacgcacgaggcatccgccgcgacgctgctggtc
gactgccgcaacgcgctcggcgaaggcgcgacgtggtgcgacgccgcgcacgcgctgtac
tgggtcgacatcgaaggcgcgcgcctgtggcgatggcgcgcggcgggcgcgcacggcggc
gagcgctgcgacagctgggagatgcccgagcgcatcgcgtgcttcgcgctcaccggcgat
ccggacgtgctgctcgtcggcctcgcgtcgcgtctcgcgttcttcgatacgcgccggcgg
gcgctcacgccgatcgtcgatgtcgagcccgatcggccgacacggctgaacgacggccgc
tgcgaccgcgcgggcgcgttcgtgttcgggacgaaggacgagagcggcggcgcgtcgccg
cgggcgatcggcggctattaccggctgaacgcggacttgagcctgcagcggctcgcgctg
ccgcccgcggcgatcgcgaacggcatcgcgttttcgccggacggctcggcgatgtatttc
tgcgattcgccgacgcgggaaatccaggtgtgcgactaccggccgggcggcgatgtcgat
cgcgtccggtcgttcgtgcggctggccgatgagcatggcgagccggacggctccacggtc
gacgcgagcggcggcgtatggaatgcgcagtggggcggcgcgcgggtggtgcgctacgat
gcgcaaggcgtcgagaccgaccgcatcgcggtgccgacgccgcagccgagctgcgtgacg
ctcgatgccgccgggcggctgtacgtgacgagcgcgcgcgtcggtctcgacgacggcgcg
ctcgcgggcaaccccggcgcgggcggcgtgttcgtcgcgcacacgcgccatccggggggc
gcgacgccgcgcttcgcgctcgcgcgccacgcatga

DBGET integrated database retrieval system