KEGG   Burkholderia pseudomallei NCTC 13179: BBK_4684Help
Entry
BBK_4684          CDS       T02894                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Pathway
bpk00010  Glycolysis / Gluconeogenesis
bpk00071  Fatty acid degradation
bpk00350  Tyrosine metabolism
bpk00625  Chloroalkane and chloroalkene degradation
bpk00626  Naphthalene degradation
bpk01100  Metabolic pathways
bpk01110  Biosynthesis of secondary metabolites
bpk01120  Microbial metabolism in diverse environments
bpk01130  Biosynthesis of antibiotics
bpk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBK_4684
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBK_4684
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BBK_4684
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BBK_4684
   00626 Naphthalene degradation
    BBK_4684
Enzymes [BR:bpk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BBK_4684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AGZ30520
Position
2:complement(1462862..1463887)
Genome map
AA seq 341 aa AA seqDB search
MAQYMKAAVVHAFGEPLRIEEVPVPTPGAGQILVNVKASGVCHTDLHAADGDWPVKPTLP
FIPGHEGVGFVAAVGEGVRHVKEGDRVGVPWLYTACGHCEYCQTGWETLCHEQQNTGYSV
NGSYAEYVLADPNYVGHLPSNVAFDEIAPILCAGVTVYKGIRVTDTRPGQWIAISGIGGL
GHVAVQYAKAMGLHVVAVDVAPQKLELARKLGATFVVDASKDDPAAVIQKEIGGVHGVLV
TAVSRGAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
DFAAEGLVRAHIHRDKLEHINGVFSALREGKVDGRIVLTGQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaatacatgaaggccgcggtggtgcatgcattcggcgaaccgcttcggatcgag
gaggtgcccgtgccgacgcccggcgcggggcagattctcgtgaacgtcaaggcatcgggc
gtgtgccataccgatctgcacgcggccgacggcgactggcccgtcaagccgacgctgccg
ttcattccggggcacgagggcgtcggcttcgtcgcggcggtgggcgaaggcgtgaggcac
gtgaaggagggcgatcgcgtcggcgtgccttggctctataccgcgtgcggccattgcgag
tattgccagaccggctgggagacgctgtgccacgagcagcagaacaccggctattcggtg
aacggcagctacgcggaatacgtgctcgccgatccgaactacgtcggccatctgccgagc
aacgtcgcgttcgacgagatcgcgccgatcctgtgcgcgggcgtgaccgtctacaagggc
attcgggtgaccgacacgcgcccggggcaatggatcgcgatctcggggatcggcgggctc
gggcacgtcgcggtgcagtacgcgaaggcgatggggctgcacgtggtcgcggtggacgtc
gcgccgcagaagctcgagcttgcgcgcaagctgggcgcgacgttcgtcgtcgatgcgtcg
aaggacgatccggcggcggtgatccagaaggagatcggcggcgtgcacggcgtgctcgtg
acggccgtgtcgcgcggcgcgttcgcgcaggcgctcggcatggtgaggcgcggcgggacg
gtctcgctgaacgggctgccgccgggcgattttccgctgccgatcttctcgacggtgctc
aacgggatcacggtgcgaggctcgatcgtcggcacgcggcgcgatctccaggaatcgctc
gatttcgcggccgaagggctcgtgcgcgcgcatatccatcgcgacaagctcgagcacatc
aacggcgtgttctcggcgctgcgtgaagggaaggtcgacgggcggatcgtgttgaccggg
caatga

DBGET integrated database retrieval system