KEGG   Burkholderia pseudomallei NCTC 13179: BBK_4726Help
Entry
BBK_4726          CDS       T02894                                 

Definition
(GenBank) deoxyribonuclease II family protein
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Brite
Enzymes [BR:bpk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     BBK_4726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNase_II
Motif
Other DBs
NCBI-ProteinID: AGZ32783
Position
2:1513713..1514765
Genome map
AA seq 350 aa AA seqDB search
MTISPRDEQNRSVDLWFAYKVPKLTKDTDSDSATGYEYVYYDREIGSVQKSPNRMNNPKG
ALFYTLDSIFGDPGSTTGWILYNDEMPADADRSNNATLGHTKGVIAFDIASNSALWLLHS
WPKYTSPSAPGVPTPLYGQTFLCVSLDLETAGKIAAQMALHQQPQVYLPRTAGLDHASPL
YTLTQPLNASAPGDSDSLDFKTRGGAPFKVIAKNRKWGKDFWNDLVGPTLKADMDVETWI
RGKIPPILDSDGVHKTYDIKFIDLRKLGAPWAWPETQDHAKWGITTTDDWVCVGDINRMV
TQEKRGGGTIAFQDPQLWKALSQTDLIVPPPGKTEAQARAIIHRTHQPAD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgactatctcgccgcgcgacgaacagaatcgatcggtcgatctatggttcgcctacaaa
gtgccgaagctcacgaaggataccgacagcgacagcgcaaccggctatgaatacgtgtat
tacgatcgcgaaatcgggtcggtgcagaagtcgccgaatcggatgaacaacccgaaaggg
gcgctgttctacacactcgattcgatcttcggcgatccgggcagcacgacgggctggatt
ctctacaacgacgaaatgccggccgatgcggaccgttcgaacaatgcgacgctcggccat
acgaaaggcgtgatcgccttcgacatcgcgtcgaactccgccttgtggctgctgcactcg
tggccgaaatacacgagcccgtcggcccccggcgtgccgacgccgctgtacgggcagacg
ttcctgtgtgtgagcctcgatctcgagacggccggcaagatcgccgcgcagatggcgctg
catcagcagccgcaggtctacctgccgcgcaccgccgggctcgatcacgcgagcccgcta
tacacgctcacgcagccgctcaacgcgtccgcgcccggcgattcggattcgctcgacttc
aagacccgcggcggcgcgccgttcaaggtgatcgcgaagaatcgcaagtggggcaaggat
ttctggaacgatctcgtcggcccgacgctgaaggccgacatggacgtcgagacatggatc
cgcggcaagatcccgcccattctcgactccgacggcgtgcacaagacctacgacatcaag
ttcatcgatctgcgcaagctcggcgcgccatgggcatggcccgaaacgcaggaccatgcg
aaatggggcatcacgacgaccgacgactgggtgtgcgtcggcgatatcaatcgaatggtg
acgcaggaaaagcgcggcggcggcacgatcgccttccaggatccgcaattgtggaaggcg
ctgtcgcagaccgatctgatcgtgccgccgcccggcaagaccgaagcgcaggcgcgcgcg
ataatccatagaacgcaccagccggccgactag

DBGET integrated database retrieval system