KEGG   Burkholderia pseudomallei NCTC 13179: BBK_5040Help
Entry
BBK_5040          CDS       T02894                                 

Definition
(GenBank) phosphatidylserine decarboxylase family protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Pathway
bpk00564  Glycerophospholipid metabolism
bpk01100  Metabolic pathways
bpk01110  Biosynthesis of secondary metabolites
Module
bpk_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bpk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBK_5040
Enzymes [BR:bpk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     BBK_5040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase PSDC Metal_resist
Motif
Other DBs
NCBI-ProteinID: AGZ31536
Position
2:complement(1882045..1883346)
Genome map
AA seq 433 aa AA seqDB search
MTNRTNATHATNATNATNAAREAAAERRRLGGWLPAEEAALARYRKTLAAHAREHADGVP
MTEAVRELAALAEGEPPLRMALTRAIDEARSRGYELGYETIGELMAVIDFVMTYAPPFSE
SGLVVCPLNALLDWPLCMPSGYAFFRDRAVNAQLKRVLNVWCGFLGGPHSRAHLNASEPD
GWFSAEAVKRIGMSQFHCDPQLPYWGFASWNDFFTRRFLPDARPVAAPDDPAVIVSACEA
APYHVAHDLKLLDTFWIKSQPYSLRDIFTAARGELARGFVGGSLYQAFLSAYDYHRWHAP
VAGRIAHAYLVDGTYYSSTEAEGADPAGLNDSQGYMTAVATRAVIVIDADAPEIGRVACV
FVGMGEVSSCMIDALPGQHVEKGEEIGYFQYGGSTYCMLFEPGVIGSFVAHPRYHEGAPA
VQVNAEVAAVAAK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaccgaacgaacgcaacccacgcgacgaacgcgacgaacgcgacaaatgccgcc
cgtgaggcggccgccgagcgccgacgcctaggcggatggctgcccgccgaggaggcggcg
ctcgcgcgctatcggaagacgctcgccgcgcacgcgcgcgagcacgcggacggcgtgccg
atgacggaggcggtgcgcgagctcgcggcgctcgccgaaggcgagccgccgctgcgcatg
gcgctgacgcgcgcgatcgacgaggcgcgctcgcgcggctacgagctcggctacgagacg
atcggcgaactgatggcggtgatcgatttcgtgatgacgtacgcgccgccgttcagcgaa
tccgggctcgtggtctgcccgctgaacgcgctgctcgactggccgctttgcatgccgtcc
ggctacgcgttctttcgcgaccgcgcggtgaacgcgcaactcaagcgcgtgctgaacgta
tggtgcggctttctgggcggcccgcattcgcgcgcgcacctgaacgcgtcggagccggac
ggctggttcagcgcggaggccgtgaagcggatcggcatgtcgcagttccattgcgatccg
caactgccctactggggcttcgcctcgtggaacgatttctttacgcggcgctttctgccc
gacgcgcggcccgtcgcggcgccggacgatccggccgtgatcgtcagcgcatgcgaggcc
gcgccgtatcacgtcgcgcacgatctgaagctgctcgacacgttctggatcaagtcgcag
ccgtattcgctgcgcgacatcttcaccgcggcgcgcggcgagctcgcgcgcggcttcgtc
ggcggctcgctgtaccaggcgttcctgagcgcctacgattatcaccgctggcatgcgccc
gtcgcggggcgcatcgcgcacgcgtatctcgtcgacggcacctactattcgagcaccgag
gccgaaggcgcggacccggccgggctcaacgattcgcagggctacatgacggccgtcgcg
acgcgcgcggtgatcgtcatcgatgccgatgcgccggagatcggccgcgtcgcatgcgtg
ttcgtcgggatgggcgaagtgtcgtcgtgcatgatcgacgcgctgcccgggcagcatgtc
gagaagggcgaggaaatcggctacttccagtacggcggctcgacatactgcatgctcttc
gagccgggcgtgatcggcagcttcgtcgcgcatccgcgttatcacgaaggcgcgccggcc
gtgcaggtgaacgcggaagtggcggccgtcgcggcgaagtga

DBGET integrated database retrieval system