KEGG   Burkholderia pseudomallei NCTC 13179: BBK_5173Help
Entry
BBK_5173          CDS       T02894                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Pathway
bpk00040  Pentose and glucuronate interconversions
bpk00053  Ascorbate and aldarate metabolism
bpk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BBK_5173
   00053 Ascorbate and aldarate metabolism
    BBK_5173
Enzymes [BR:bpk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     BBK_5173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGZ30774
Position
2:2049103..2050683
Genome map
AA seq 526 aa AA seqDB search
MQITGEMLIGAAAVRGSEGTMRAYAPAQGVELEPTFGAGGAADVDRACRLANAAFDPFRQ
APLETRARFLEAIAERIVGLGDPLIERAHAESALPVARLEGERARTVGQLRLFAAIVRDG
RWLSATLDSAQPERKPLPRADLRLQKIPVGPVAVFGASNFPLAFSVAGGDTASAFAAGCP
VVAKAHPAHLGTSELVGRAIRQAVADCGLHEGVFSLVVGAGNAIGEALVAHPAIRAVGFT
GSRAGGLALMGVAARRREPIPVFAEMSSINPFFVLPGALRARGAQIAQGFVESLTLGVGQ
FCTNPGLVVALEGPDLKAFVDAAAQALSQKGAQTMLTSGIASSYESAVAARRAAAGVSEV
ARGARSDARNAALPALFTTTHTQFVQNPQLEAEIFGPTSLVVACRDIDEMIALAEHVEGQ
LSATLHLEDDDVDLARKLLPTLERRAGRIVANGYPTGVEVAYAMVHGGPFPATSDPRSTS
VGALAIERFLRPVCYQDLPAALLPEALADANPLGLWRLRDGQLGKA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcaccggcgagatgttgattggcgcggccgcggtgcgcggtagcgaaggcacg
atgcgcgcttacgcgccggcgcagggcgtcgagctcgagccgacgttcggcgcgggcggt
gcggccgacgtcgatcgcgcgtgccgcctcgcgaatgccgctttcgatccctttcgtcag
gcgccgctcgagacgcgcgcacgctttctcgaggcgatcgccgagcgcatcgtcgggctc
ggcgatccattgatcgaacgcgcgcacgcggaatcggcgctgcccgtcgcgcggctcgaa
ggcgagcgcgcgcgcacggtcggtcagctcaggctcttcgcggcgatcgtgcgcgacggc
cgctggctgagcgcgacgctcgattccgcgcagcccgagcgcaagccgctgccgcgcgcc
gatctgcgcttgcagaagattcccgtcggcccggtcgcggtgttcggcgcgagcaatttc
ccgctcgcgttctcggtcgcgggcggcgacaccgcttcggcgttcgcggctggctgcccc
gtcgtcgcgaaggcgcaccccgcgcatctcggcacgtcggagctcgtcgggcgcgcgatc
cggcaggctgtcgccgattgcggtttgcacgagggcgtgttctcgctcgtcgtcggcgcg
ggcaacgcgatcggcgaggcgctcgtcgcgcatcccgcgatcagggcggtcggcttcacc
ggctcgcgcgcgggcggccttgcgttgatgggcgttgccgcgcggcggcgcgagccgatt
ccggtcttcgcggaaatgagcagcatcaatccgttcttcgtgttgcccggcgcgttgcgc
gcacgcggtgcgcaaatcgcgcaaggcttcgtcgaatcgctgacgctcggcgtcgggcag
ttctgcacgaacccggggctcgtcgtcgcgctcgaagggcccgacctgaaggcgttcgtc
gacgcggccgcgcaggcgctctcgcaaaagggcgcgcagacgatgctgacctcgggcatc
gcgtcgtcttacgagagcgcggtcgcggcgcgccgcgcggccgcgggcgtcagcgaggtc
gcgcgcggcgcgcgcagcgacgcgcggaacgccgcgttgcccgcgctcttcacgacgacg
cacacgcagttcgtccagaacccgcagctcgaagccgagattttcgggccgacgtcgctc
gtcgtcgcgtgccgcgacatcgacgagatgatcgcgcttgccgagcatgtcgaggggcaa
ctgagcgcgacgctgcatctcgaagacgacgatgtcgatctggcgcgtaaactgctgccg
acgctcgagcgccgcgccggccgcatcgtcgcgaacggctatccgacgggcgtcgaggtc
gcgtacgcgatggtgcacggcgggccgtttccggcgacgtcggacccgcgcagcacatcg
gtgggcgcgcttgcgatcgagcgcttcctgcggcccgtctgctatcaggatttgccggcg
gcgttgttgcccgaggcgctcgccgacgcgaatccgctcggcctctggcgcctgcgcgac
ggccaactcggcaaggcgtga

DBGET integrated database retrieval system