KEGG   Burkholderia pseudomallei NCTC 13179: BBK_5242Help
Entry
BBK_5242          CDS       T02894                                 

Definition
(GenBank) PAAR motif family protein
Organism
bpk  Burkholderia pseudomallei NCTC 13179
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAAR_motif
Motif
Other DBs
NCBI-ProteinID: AGZ32433
Position
2:2141034..2141303
Genome map
AA seq 89 aa AA seqDB search
MTIPAARVGDAIGHGGVLVTGSGDVFMNGIPAGFVAGSVAVCALHASAQAVVAASGTVFI
NRLPAAFVGGVTSCGAPIVSGSPDVMIGS
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcccggcagcaagagtgggagatgcgatcggacatggcggcgttctcgtcacc
ggctcaggtgacgtattcatgaacggtattcccgcgggattcgtcgccggcagcgtcgcc
gtgtgcgcgctgcatgcgtccgcgcaggcggtggtcgccgcatcgggaacggtattcatc
aatcgcctcccggctgcgttcgtcggtggcgtgacgtcgtgcggcgcgccgatcgtttca
ggctcgcccgacgtcatgatcggctcataa

DBGET integrated database retrieval system