KEGG   Burkholderia pseudomallei NCTC 13179: BBK_5250
Entry
BBK_5250          CDS       T02894                                 

Definition
(GenBank) impE family protein
  KO
K11898  type VI secretion system protein ImpE
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Brite
KEGG Orthology (KO) [BR:bpk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpk02044]
    BBK_5250
Secretion system [BR:bpk02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   BBK_5250
SSDB
Motif
Pfam: ImpE
Other DBs
NCBI-ProteinID: AGZ30832
Position
2:complement(2151657..2152463)
AA seq 268 aa
MLRDALRAQSFEEIKARTAEAVRKRPSDTRERWLLFQLLCIDGAWERALKQLQTWAGLEP
QGEARAQLHRGLIRCEMFRADVFAGKRTPGFIDAQPAWVDTLLQANAKLGAGDVAAADTL
REAAFHCAPVTRGESAEMGSFAWLTDSDTRLGPIFEIAVAGGYRWIPFEQLKSITFTPAG
TLTDLVWRPVTALTLDATVLRGYAPTRYSGSENGATAIRLASETTWRDIGTTNVVALGQR
TWTTDQGDWGMLQIGGCRFTGESDDAAS
NT seq 807 nt   +upstreamnt  +downstreamnt
atgctgcgcgacgcgctgcgcgcccagtctttcgaggaaatcaaggcgcgcacggccgag
gcggtcagaaagcggccatccgacacgcgggaacgctggctactgtttcagttgctttgc
atcgacggcgcgtgggagcgcgcgctcaaacagctgcaaacctgggccgggctcgagccg
cagggcgaggcgcgcgcgcaactgcatcgcggcctgatccgatgcgaaatgttccgggcc
gacgtgtttgccggcaagcgaacgccggggttcatcgacgcgcagcccgcctgggtcgac
acgctcctccaagccaatgcgaagctcggcgccggcgacgtcgcggcggcggacacgctg
cgcgaggccgcgttccactgcgcccctgtcacccgcggggaaagcgccgaaatgggaagc
ttcgcatggcttaccgacagcgacacccgcctcggtccgatcttcgaaatagcggttgca
ggcggctatcgatggattccgttcgaacaactgaagtccatcacgtttacgcccgccggc
acgctgaccgacctggtctggcggccggtcacggcactcacgctcgatgccacggttctc
cgcggctatgcgcccacccgctattcgggatcggagaacggcgcgaccgcgatccgcttg
gccagcgagacgacttggcgcgacatcggcaccaccaatgtcgtggcgctcggacaacga
acatggaccaccgatcagggcgactggggcatgctccagatcggcggatgccgcttcacg
ggcgaaagcgacgatgcggcatcctga

DBGET integrated database retrieval system