KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_0072Help
Entry
BURPS1106A_0072   CDS       T00480                                 

Definition
(GenBank) acetyl-CoA acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00071  Fatty acid degradation
bpl00072  Synthesis and degradation of ketone bodies
bpl00280  Valine, leucine and isoleucine degradation
bpl00310  Lysine degradation
bpl00362  Benzoate degradation
bpl00380  Tryptophan metabolism
bpl00620  Pyruvate metabolism
bpl00630  Glyoxylate and dicarboxylate metabolism
bpl00640  Propanoate metabolism
bpl00650  Butanoate metabolism
bpl00900  Terpenoid backbone biosynthesis
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
bpl01120  Microbial metabolism in diverse environments
bpl01130  Biosynthesis of antibiotics
bpl01200  Carbon metabolism
bpl01212  Fatty acid metabolism
bpl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BURPS1106A_0072
   00630 Glyoxylate and dicarboxylate metabolism
    BURPS1106A_0072
   00640 Propanoate metabolism
    BURPS1106A_0072
   00650 Butanoate metabolism
    BURPS1106A_0072
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BURPS1106A_0072
   00072 Synthesis and degradation of ketone bodies
    BURPS1106A_0072
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BURPS1106A_0072
   00310 Lysine degradation
    BURPS1106A_0072
   00380 Tryptophan metabolism
    BURPS1106A_0072
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BURPS1106A_0072
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BURPS1106A_0072
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BURPS1106A_0072
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpl04147]
    BURPS1106A_0072
Enzymes [BR:bpl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BURPS1106A_0072
Exosome [BR:bpl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BURPS1106A_0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABN91482
UniProt: A3NPT6
Position
I:69172..70377
Genome map
AA seq 401 aa AA seqDB search
MEAYIFDAVRTPRGKGKKDGSLHGVTPLALAATALRAIRDRNGLDTRAVDDVVLGCVEPV
GEQGACIGRIAVLAAGYAETTAGVQINRFCASGLEACNMAAAQVMSGQSEMAIGGGVESM
SRVPMGSSGGAWPVDPAIAIPSYFVPQGVSADTIATKWGYSRADVDAYAAESHRRAHAAA
QAGWFARSIVPVRDANGLTILDHDETIRPQTTPETLATLKPSFAELGEMYGFDAVIRQRY
PELERIEHVHHAGNSSGIVDGASAVLIGSLEAGKRAGLAPRARIRSFASIGSEPSIMLTG
PAYAAQKALERAGMRAADIDLYELNEAFASVVLRFMDAMAIAHDRINVNGGAIAMGHPLG
ATGAMILGTLLDELERRGAATGLATLCVGAGMGTATIIERI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaagcctacattttcgacgccgtgcgcacgccgcgcggcaaaggcaagaaggacggc
agcctgcacggcgtcacgccgctcgcgctcgccgcaaccgcgctgcgcgcgattcgcgac
cgcaacggtctcgacacgcgcgccgtcgacgacgtcgtgctcggctgcgtcgagcccgtc
ggcgagcaaggcgcgtgcatcggccgcatcgcggtgctcgcggccggctacgcggaaacc
acggccggcgtgcagatcaaccgcttctgcgcatcgggcctcgaggcgtgcaacatggcc
gccgcgcaggtgatgtccggccagtcggagatggcgatcggcggcggcgtcgagagcatg
tcgcgcgtgccgatgggctcgagcggcggcgcgtggcccgtcgatccggcgatcgcgatt
ccgagctatttcgtgccgcagggcgtatcggccgacacgatcgcgacgaagtggggctac
agccgtgccgatgtcgacgcgtacgccgccgagagccaccgccgcgcgcacgcggcggcg
caggcgggctggttcgcgcgctcgatcgtgccggtgcgcgacgcgaacggcctgacgatc
ctcgatcacgacgagacgatccgcccgcagacgacgcccgagacgctcgcgacgctcaag
ccttcgttcgccgaactgggtgagatgtacggcttcgacgcggtgatccgccagcgctat
ccggagctcgaacgcatcgagcacgtgcaccacgcgggcaacagctcggggatcgtcgac
ggcgcgtcggccgtgctgatcggctcgctcgaggcgggcaagcgcgcgggcctcgcgccg
cgcgcgcgaatccgctcgttcgcgagcatcggctcggagccgtcgatcatgctgacaggg
ccggcctacgcggcgcagaaggcgctcgagcgcgccggcatgcgcgcggccgacatcgat
ctgtacgagctgaacgaagcgttcgcgtcggtcgtgctgcgcttcatggacgcgatggcg
attgcgcacgaccggatcaacgtgaacggcggtgcgatcgcgatgggccatccgctcggc
gcgacgggcgcgatgatcctcggcacgctgctcgacgagctcgagcggcgcggcgcggcc
acgggccttgcaacgctgtgcgtcggcgccggcatgggcacggcgaccatcatcgaacgg
atttga

DBGET integrated database retrieval system