KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_0319Help
Entry
BURPS1106A_0319   CDS       T00480                                 

Gene name
argG
Definition
(GenBank) argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00220  Arginine biosynthesis
bpl00250  Alanine, aspartate and glutamate metabolism
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
bpl01130  Biosynthesis of antibiotics
bpl01230  Biosynthesis of amino acids
Module
bpl_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BURPS1106A_0319 (argG)
   00220 Arginine biosynthesis
    BURPS1106A_0319 (argG)
Enzymes [BR:bpl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     BURPS1106A_0319 (argG)
Exosome [BR:bpl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BURPS1106A_0319 (argG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth
Motif
Other DBs
NCBI-ProteinID: ABN90423
UniProt: A3NQI1
Position
I:293287..294627
Genome map
AA seq 446 aa AA seqDB search
MTTILENLPAGQKVGIAFSGGLDTSAALHWMRIKGAVPYAYTANLGQPDEDDYDAIPKRA
IQYGAEGARLIDCRAQLVAEGIAALQCGAFHISTAGVTYFNTTPIGRAVTGTMLVAAMKE
DGVNIWGDGSTYKGNDIERFYRYGLLVNPDLKIYKPWLDQQFIDELGGRAEMSEFMRQAG
FEYKMSAEKAYSTDSNLLGATHEAKDLESLESGIKIVNPIMGVAFWRDDVKIDKEEVTIR
FEEGRPVALNGVEYKDAVALLLEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGLALL
YIAYERLVTGIHNEDTIEQYRENGRRLGRLLYQGRWFDPQAIMLRETAQRWVARAVTGEV
TVELRRGNDYSIIGTRSPNLTYQPERLSMEKVQSMFSPRDRIGQLTMRNLDITDTRDKLR
IYSQVGLLAAGESSALPKLKEDESGN
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgattcttgaaaatctcccggccggccagaaggtcggcattgcgttctccggc
ggcctcgacacgagcgccgcgctgcactggatgcgcatcaagggagccgttccttacgca
tacacggccaatctcggccagcccgacgaagacgactacgacgcgatcccgaagcgcgcg
atccagtacggcgccgaaggcgcgcgcctgatcgactgccgcgcgcagctcgtcgccgaa
gggatcgcggcgctccagtgcggcgcgttccacatttcgacggccggcgtcacgtatttc
aatacgaccccgattggccgcgccgtgacgggcacgatgctcgttgccgcgatgaaggaa
gacggcgtcaacatctggggcgacggcagcacgtacaagggcaacgacatcgagcgcttc
taccgctatggcctgctcgtcaatccggatctgaagatctacaagccgtggctcgaccag
cagttcatcgacgagctcggcggccgcgcggaaatgtccgaattcatgcgccaggccggt
ttcgagtacaagatgtcggccgagaaggcgtactcgaccgattcgaacctgctcggcgcg
acgcacgaggcgaaggatctcgagagcctcgagagcggcatcaagatcgtcaatccgatc
atgggcgtcgcgttctggcgcgacgacgtgaagatcgacaaggaagaagtgacgatccgc
ttcgaagaggggcgcccggtcgcgctgaacggcgtcgagtacaaggatgcggtcgcgctg
ctgctcgaggcgaaccggatcggcgggcgccacggcctcgggatgagcgaccagatcgag
aaccggatcatcgaggcgaagagccgcggcatctatgaggccccggggctcgcgctgctg
tacatcgcatacgagcgcctcgtcaccggcatccacaacgaggacacgatcgagcagtac
cgcgagaacggccgtcgtctcggccgcctgctgtaccagggccgctggttcgacccgcag
gcgatcatgctgcgcgagacggcgcagcgctgggtcgcgcgcgcggtcacgggcgaggtg
acggtcgagctgcgccgcggcaacgattattcgatcatcggcacgcgctcgcccaacctc
acgtaccagccggagcgcctgtcgatggagaaggtgcaatcgatgttctcgccgcgcgac
cggatcggccaactgacgatgcgcaacctcgacatcaccgatacgcgcgacaagctgcgc
atctattcgcaagtcggcctgctggcggcgggcgaatcgtcggcgctgccgaagctgaag
gaagacgagagcggcaactga

DBGET integrated database retrieval system