KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1547Help
Entry
BURPS1106A_1547   CDS       T00480                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Imm52
Motif
Other DBs
NCBI-ProteinID: ABN92608
UniProt: A3NTZ7
Position
I:complement(1499833..1500435)
Genome map
AA seq 200 aa AA seqDB search
MRYENWMLKGDNQEDATRYHVYDAAGIATPAALAVLREEFRNSKDFTYVAMWDGNLASDN
GASISCHVGDKSLPDTLTLRIEGERWKAYAAISGIVSTMVTIFSPALVEVSFDEYAVKQV
FDDKPGVGWMLYLPKVITQQQVPEARALIPVPAKGKQTGTIIISVTDAPFSVDNPEHVAI
ANRIEIRLVDQDLLPAYVDI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgcgatacgagaactggatgctcaaaggagacaaccaggaagacgcgactaggtaccac
gtctatgacgctgccggcatcgctacaccagcggcgctcgccgtacttcgagaggagttt
cgcaacagcaaagacttcacctacgtagcaatgtgggatggcaatctcgctagcgacaac
ggcgcgtccatatcgtgccacgtcggtgataaatcccttcctgacacattgactcttcgc
atcgagggcgaacggtggaaagcctacgcggccatttccggaatcgtatcgacaatggtc
actatattcagcccggcactcgtcgaggtgagtttcgacgagtatgctgtaaaacaggtc
ttcgacgacaagcccggcgtcggctggatgctctacctgccgaaggtcattacgcaacag
caagttccggaagcccgagcgctgattcccgtacccgccaaaggcaagcaaaccggcacg
atcatcatcagcgtcacggacgccccgttctcggtcgacaatcccgagcacgtcgcgatc
gcgaatcgcatcgagatccggctcgtcgatcaagacttgctccccgcctacgtcgatatc
tga

DBGET integrated database retrieval system