KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1549Help
Entry
BURPS1106A_1549   CDS       T00480                                 

Definition
(GenBank) transposase B
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve_3 rve HTH_21 rve_2 DDE_Tnp_IS240
Motif
Other DBs
NCBI-ProteinID: ABN91333
UniProt: A3NPV6
Position
I:complement(1500640..1501494)
Genome map
AA seq 284 aa AA seqDB search
MVSAPARRQQVTYAKARGLSERRACALMSVARSALHYESTLAVRDAPVLAAMSILSAQYP
RYGYRRIQIFLERQGHPMSADRAWRLWRLAGLQVPRKRPRRRVSVQRPRPQPATAARHVW
AYDFVFDACANGQQLKCLTVIDEYTRECLAIDVAGSIRSGRVIEVLSQLVSLHGAPRYLR
SDNGPEFVSRATLKWAAQNGMDMALSDPGKPWQNGADESFNGKFRDECLSLEWFRTRTEA
KVVIEQWRRHYNAIRPHSSLAYLTPDEFKQRYCSTEATEAVLQD
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtggtgagcgcgcccgcccgacgccagcaggtcacctatgcgaaagcacggggcctgtcg
gagcgacgtgcgtgcgcgctgatgtcggtcgcccgatcggcgctgcattacgaatcaacg
ctggccgtgcgggacgcgccggtgctggcagcgatgagcattctgtcggcgcaatatccg
cgttatggttaccgccgcatccagatctttctggagcggcaaggtcacccgatgagcgcc
gaccgggcttggcggctgtggcgtcttgccgggttgcaggtgccgcgcaagcgaccccgt
cgacgcgtgtcggtccaacgccctcggccgcagccggcgacggcggcacgacacgtttgg
gcgtacgacttcgtattcgacgcgtgcgccaacggccagcagttgaagtgtctgacggtg
atcgatgagtacacgcgtgaatgcctggcaatcgacgtggccggatcgattcgttccgga
cgtgtcatcgaagtcctgtcccaactggtcagccttcatggtgcacctcgttacttgcgt
tcggacaacggcccagagttcgtatcgcgggccaccctgaagtgggctgcacagaacggc
atggacatggcgcttagcgatcccggcaagccttggcagaacggcgcggacgagagcttc
aacggcaagttccgagatgaatgcttgagccttgaatggtttcgaacgcgcacggaagcg
aaggttgtgatcgagcagtggcggcgtcactacaatgccatccgaccgcattcgagtctg
gcctatctgacgcccgacgagttcaagcagcggtattgttcaactgaagcaaccgaggcc
gttctccaagattga

DBGET integrated database retrieval system