KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1551Help
Entry
BURPS1106A_1551   CDS       T00480                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tox-REase-5
Motif
Other DBs
NCBI-ProteinID: ABN89632
UniProt: A3NU01
Position
I:complement(1501818..1502288)
Genome map
AA seq 156 aa AA seqDB search
MGGATVAGTASLSGDTPKEDSKATPDVRALPRTGESCKKCPPESGAKIRRNHGVNWNAYR
YQARITGFAFDTEECRWSDEWNWLGIDFDGFQPGECLLQETKGNYDQFLDGSIPKADKFF
KGFDSMEATAIRQSAAVRANPPARLMWYFQTPLARQ
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
ttgggcggcgcgacggtggcgggaacggcgagtctgtcgggtgacacgccgaaggaggac
agcaaggcgacgccggatgtgcgggccctcccgcgcaccggcgaaagctgcaagaaatgc
ccgcccgagagtggagcaaagattcgccgcaatcatggcgtcaactggaatgcgtaccga
tatcaggcacgcattactggctttgcgttcgacactgaggaatgccgctggagcgacgag
tggaattggctcggcattgacttcgacggcttccagcccggcgaatgcttgctacaggaa
accaagggcaactacgatcagttcctcgatggttctatcccgaaggccgacaaatttttc
aaaggattcgactcgatggaagccactgccatacgacagagcgcggccgtgcgggccaat
ccgccagcacgactgatgtggtacttccaaacgccactcgcgcgacaatga

DBGET integrated database retrieval system