KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1565Help
Entry
BURPS1106A_1565   CDS       T00480                                 

Gene name
glgX
Definition
(GenBank) glycogen debranching enzyme GlgX
  KO
K01214  isoamylase [EC:3.2.1.68]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00500  Starch and sucrose metabolism
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BURPS1106A_1565 (glgX)
Enzymes [BR:bpl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.68  isoamylase
     BURPS1106A_1565 (glgX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ABN91544
UniProt: A3NU15
Position
I:complement(1516151..1518259)
Genome map
AA seq 702 aa AA seqDB search
MPTPTPDRLEPGRSYPLGAHWDGLGVNFAVFSAHARRVQLCLFDPTGRREIARLDLPECT
DEIWHGYLPDAHPGTVYAFRADGAYEPQHGHRFNPHKLLLDPYARKLVGQFRWSDALFGY
RLHSSRADLSIDRRDSAPAMPKCVVVDEAVDWSTDRRPCVPWRDTVIYEAHVRGVSMRRA
ELRAPERGTFAALACPAFIDHLLALGVTSVELLPVHAFMHARALVNLGLCNYWGYDTAAF
FAPEPSYLATRRLDEMRIAIRQLHAAGIEVLLDVVYNHTCEGNQLGPTICWRGLDNASYY
RLAPDDPRRHIDETGCGNTLDLSHPRVLQMVMDSLRYWSNAFNVDGFRFDLCATLGREAA
GFDPGAGFFDALRQDPVLATRKLIAEPWDVGPGGYQLGRHPAGFAEWNDRFRDTVRRFWR
GDAGMRPELAARLAGSADLFNHHGRRTWSTVNFVAAHDGFTLADLVSYAAKHNDANGEDN
RDGRDDNCSANWGAEGPTEDRQVRAVRARVARSLLTTLFAALGTPMLLGGDEFGRTQQGN
NNAYCQDNELSWFDWSAAESADGRTMIHFVGRLAALRRAYPVLSEPRYPSGERDGAPGLH
EIDWFDERGDALTVPAWHDRERRALTMRRVGNGRAGRPEALLLMLNASSDAIVFHAPPPS
LVYRILLDSAAPDAAPRLMPADGVEIAAHAAVIAAASVPEAG
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgccgacacccacgcccgatcgcctcgaaccggggcgcagctatccgctcggcgcgcac
tgggacgggctcggcgtgaacttcgcggtattttccgcgcacgcccgccgggttcagctc
tgcctgttcgatccgaccggacgccgcgagatcgcgcgcctcgatctgcccgaatgcacg
gacgaaatctggcacggctacctgcccgacgcgcatccgggcacggtctacgcgttccgc
gcggacggcgcgtacgagccgcagcacgggcaccgcttcaatccgcacaagctgctgctc
gatccgtacgcgcgtaagctcgtcgggcagtttcgctggtccgacgcgctgttcggctac
cggctgcattcgagtcgcgcggacttgtcgatcgaccggcgcgattcggcgcccgcgatg
ccgaaatgcgtggtcgtcgacgaggccgtcgactggagcaccgaccgccgcccgtgcgtg
ccgtggcgcgatacggtgatctacgaagcccacgtgcgcggcgtgtcgatgcggcgcgcc
gagctgcgcgcgccggaacggggcacgttcgccgcgctcgcctgccccgcgttcatcgat
cacctgctcgcactcggcgtgacgagcgtcgagctgctgccggtgcacgcgttcatgcac
gcgcgcgcgctcgtcaatctcgggctgtgcaactactggggctacgacaccgccgcgttc
ttcgcgcccgagccctcgtatctcgcgacgcgccggctcgacgagatgcgcatcgcgatc
cgccagttgcacgcggcgggcatcgaagtgctgctcgacgtcgtctacaaccatacgtgc
gagggcaatcagctcggcccgacgatctgctggcgcggcctcgacaacgcgagctactac
cggctcgcgccggacgacccgcgccgccacatcgacgagacgggctgcggcaacacgctc
gacctgtcgcacccgcgcgtgctgcagatggtgatggattcgctgcgctactggtcgaac
gcgttcaacgtcgacggctttcgcttcgatctctgcgcgacgctcggccgcgaggcggcc
ggcttcgatccgggcgcgggctttttcgacgcgctgcgtcaggaccccgtgctcgccacg
cgcaagctgatcgccgagccgtgggacgtcggcccgggcggctatcagctcggccgccat
ccggccggcttcgccgagtggaacgaccgctttcgcgacaccgtgcggcgcttctggcgc
ggcgacgccggcatgcggccggagctcgccgcgcggctcgcgggctcggccgacctgttc
aaccaccacgggcggcggacctggtcgaccgtgaacttcgtcgccgcgcacgacggcttc
acgcttgccgatctcgtctcatacgcggccaagcacaacgacgcgaacggcgaagacaac
cgcgacgggcgcgacgacaactgcagcgcgaactggggcgccgaggggcccaccgaagac
agacaggtgcgggccgtgcgcgcgcgcgtcgcgcgctcgctgctcacgacgctgttcgcc
gcgctcggcacgccgatgctgctcggcggcgacgagttcgggcgcacgcagcagggcaac
aacaacgcgtattgccaggataacgaactgtcgtggttcgactggagcgcggccgaatcg
gcggacggccgcacgatgattcacttcgtcggccggctcgcggcgctgcggcgcgcgtat
ccggtgctgtccgagccgcgctatccgtcgggcgagcgcgacggcgcgcccggcttgcac
gagatcgactggttcgacgagcgcggagacgcgctgacggtgcccgcctggcacgaccgc
gagcggcgcgcgctgacgatgcggcgggtcggcaacggacgcgcggggcggccggaggcg
ttgctgctgatgctgaacgcgtcgtccgacgcgatcgtgttccatgcgccgccgccctcg
ctcgtctaccgcattctgctcgacagcgcggcgcccgacgcggcgccgcggctgatgccc
gccgacggcgtcgagatcgccgcgcacgccgcggtgatcgcggcggcgtcggtgcccgag
gccggctga

DBGET integrated database retrieval system