KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1566Help
Entry
BURPS1106A_1566   CDS       T00480                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00500  Starch and sucrose metabolism
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BURPS1106A_1566 (glgB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpl04147]
    BURPS1106A_1566 (glgB)
Enzymes [BR:bpl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BURPS1106A_1566 (glgB)
Exosome [BR:bpl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BURPS1106A_1566 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase AMPK1_CBM Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ABN91974
UniProt: A3NU16
Position
I:complement(1518312..1520528)
Genome map
AA seq 738 aa AA seqDB search
MTDAPFDRADIDALLDARHPDPFACLGPHRVGDATVVRTLLPGALRVRAIAAGGGVLGEL
RQVDPAGCFAGALPDGRERGERPRYRLSIDWPDARQDVEDAYAFGTLLDEDALARFAAGD
PRAALACLGARALDMDGVPGVRFAVWAPGASRVSVVGDFNGWDARRHPMRLRRPWGVWEL
FVPRIGAGERYKFALRARDGAALPLKADPCACRTEAPPRTASIVADLDALERFGWHDDAW
LRARASLDLAHAPVSIYEVHPESWLRVAAEGNRSATWDELAQRLIPYAAGMGFSHVELTP
IAEYPFGGSWGYQSLSPFAPSARFGPPEGFARFVEHAHAAGLGVIVDWVPAHFPDDPHGL
GKFDGTALFEHADPREGWHPDWHTHVFNVGRREVGAFLIASALAWAHRYHVDGIRVDAVA
SMLYRDYSRAAGEWVPNVYGGRENLESIAFLKHFNDTLHGPAAPPGVATFAEESTAWPGV
TAPTAEHGLGFDFKWNMGWMHDTLAYLREDPIHRRHHHDRLTFGLVYAFSERFVLPLSHD
EVVHGKGSLAAKMPGDAWQRLANLRAYFGFMWAHPGKKLLFMGGEFAQWGEFAHDATPQW
DLLDAPAHRGVQRLVRDLNRLHAAEPALHALDDRPAGFAWLVGDDRNNSVFAFVRRDDAG
RMLVAVCNFTPVPRTDYRLGLPAPGRWAEVLNTDGAAYGGTDAGNGGALQADEIPAHGER
WSAALRLPPLATLWLRPA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgcgcccttcgatcgcgccgacatcgacgcgctcctcgacgcgcgccatccg
gacccgttcgcgtgcctcggcccgcaccgcgtcggcgacgcgacggtcgtgcgcacgctg
ctgcccggcgcgctgcgggttcgcgcgatcgcggcgggcggcggcgtgctcggcgagctg
cggcaggtcgatccggccggctgcttcgccggcgcgctgcccgatgggcgggaacgcggc
gagcggccgcgctatcggctgtcgatcgactggcccgacgcgcgacaggacgtggaggac
gcgtatgcgttcggcacgctgctcgacgaggatgcgctcgcgcgcttcgcggcgggcgat
ccgcgcgcggcgctcgcgtgcctcggcgcgcgcgcgctcgacatggatggcgtgcccggc
gtgcggttcgccgtctgggcgccgggcgcgtcgcgcgtgtcggtggtcggcgatttcaac
ggctgggatgcgcgccgccacccgatgcggctgcgccgcccgtggggcgtgtgggagctg
ttcgtgccgcgcatcggcgcgggcgagcgctacaagttcgcgctgcgcgcgcgcgacggc
gccgcgctgccgctgaaggccgacccgtgcgcgtgccgcaccgaggcgccgccgcgcacc
gcgtcgatcgtcgccgatctcgacgcgctcgagcgcttcggctggcacgacgacgcgtgg
ctgcgcgcgcgcgcgtcgctcgatctcgcgcacgcgccggtgtcgatctacgaagtccat
ccggaatcgtggctgcgcgtcgcggccgagggcaatcgcagcgcgacgtgggacgagctc
gcgcagcggctgattccgtatgcggccggcatgggcttctcgcacgtcgagctcacgccg
atcgccgagtatccgttcggcggctcgtggggctaccagtcgctatcgccgttcgcgccg
tccgcgcggttcgggccgccggaaggcttcgcgcgcttcgtcgagcacgcgcacgcggcc
ggcctcggcgtgatcgtcgactgggtgcccgcgcactttcccgacgatccgcacgggctc
ggcaaattcgacggcaccgcgctgttcgagcatgcggacccgcgcgagggatggcatccg
gactggcacacgcacgtgttcaacgtcgggcggcgcgaagtcggcgcgttcctgatcgcg
tcggcgctcgcgtgggcgcaccgctatcacgtcgacggcattcgcgtcgacgccgtcgcg
tcgatgctctaccgcgactactcgcgcgcggcgggcgaatgggtgccgaacgtgtacggc
gggcgcgagaacctcgaatcgatcgcgttcctgaagcacttcaacgacacgctgcacggg
cccgccgcgccgcccggcgtcgcgacgttcgcggaggaatcgaccgcatggcccggcgtc
accgcgccgaccgccgagcacggcctcggcttcgatttcaagtggaacatgggctggatg
cacgacacgctcgcctatctgcgcgaggacccgatccatcgccgccatcaccacgaccga
ctcacgttcgggctcgtctatgcgttctccgagcgcttcgtgctgccgctgtcgcacgac
gaagtcgtgcacggcaagggctcgctcgcggccaagatgccgggcgacgcctggcagcgc
ctcgcgaacctgcgcgcgtacttcggcttcatgtgggcgcatccgggcaagaagctgctg
ttcatgggcggcgagttcgcgcagtggggggagttcgcgcacgacgcgacgccgcagtgg
gatctgctcgacgcgcccgcgcaccggggcgtgcagcgcctcgtgcgcgacctgaaccgg
ctgcatgcggccgagccggcgctgcacgcgctcgacgaccggcccgccgggttcgcgtgg
ctcgtcggcgacgatcgcaacaacagcgtgttcgcgttcgtccgtcgcgacgatgcgggc
cgcatgctcgtcgcggtgtgcaacttcacgccggtgccgcgcaccgactatcggctcggg
ctgcccgcgccgggccgctgggccgaggtgctgaacaccgacggcgccgcatacggcggc
accgacgcgggcaacggcggcgcgctccaagccgacgagattcccgcgcacggcgagcga
tggtcggccgcgctgcgcctgccgccgctcgcgacgctatggctgcgccccgcctga

DBGET integrated database retrieval system