KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1579Help
Entry
BURPS1106A_1579   CDS       T00480                                 

Definition
(GenBank) putative lipoprotein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_44 Glyco_hydro_79C
Motif
Other DBs
NCBI-ProteinID: ABN91084
UniProt: A3NU29
Structure
PDB: 

Position
I:1531855..1533279
Genome map
AA seq 474 aa AA seqDB search
MKLGGGTVLGTLLAACGGGGGADAAAAAPQQPPPAGPSSSANVAMTLPADAPRIARDFAG
LSIEKAALSYPLLSGENGNMVGLFNRLGAGVLRIGGNSSDASGWQRTGPDETSGVITPAA
VDRLASFVRACRWRVIYGLNFVGNDPATIADEAAYAAQALGVQLAGFEIGNEPDLYAQHG
LAPNANTYPGFVSRWTTFANAIRAAVPDAVFTGPATAWNYQRYTVPFASDAAGLVSLLTQ
HHYRNPDSATIEAMLSPDPSLAPMLQALQGAASARGIGFRLAETNSYWGGGKPGVSDAHA
SALWVINFLFAVAQGGASGVNLHTGGGASYSAIKTNKTAGTVAAIGPEYYGIYLFNQAAG
GRLMQTRVDSAGTTLFAHAVAADGGGVRLILVNTDANSGYDVAVDCSSVPNARAGIVTTL
GGPSLGSLTGTQIDGATFALDGSGAPQGGRPVACVNGVLGVHVASASALLVDFA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctgggtggcggcaccgttctcggcacgttgctcgccgcatgcgggggcggtggc
ggggcggacgcagccgccgccgcgccgcagcagccgccgcccgcggggccgagctcgagc
gcgaacgtcgcgatgacgctgccggccgacgcgccgcgcatcgctcgcgatttcgcgggg
ctcagcatcgaaaaggcggcgttgagctatccgctgctgagcggcgagaacggcaacatg
gtcggcctgttcaaccggctcggcgccggcgtgttgcgcatcggcggcaatagcagcgac
gcgtccggctggcagcgcaccggtccggacgagacgtcgggcgtcatcacgcccgccgcc
gtggaccggctcgcgagcttcgttcgggcttgccgctggcgcgtgatctacgggctcaat
ttcgtcggcaacgaccccgcgacgatcgccgacgaagccgcgtatgcggcccaagcgctg
ggcgtccagctcgcgggcttcgagatcggcaacgagcccgatctctacgcgcagcatggc
ctcgcgccgaacgcgaacacctatccgggcttcgtgagccgctggaccacattcgcgaat
gcgatccgggcggcggtgcccgatgcggtgttcacgggcccggcgaccgcgtggaactat
cagcgttacaccgtgccgttcgcaagcgatgcagcgggcttggtgtcgttgctgacgcag
caccactaccgcaaccccgatagcgcgacgatcgaggcgatgctgagccccgatccgagc
ctcgcgccgatgctgcaagcgttgcagggtgcggcgagcgcgcgcggcatcggctttcgt
ctcgcggagacgaacagctattggggcggcggcaagccgggcgtgagcgatgcgcacgca
tccgcgctctgggtgatcaacttcctgttcgccgtggcgcaagggggcgcttcgggcgtg
aacctgcataccggcggcggagcgtcgtattcggcgatcaagacgaacaagaccgccggg
acggtcgcggcgatcgggccggagtactacggcatctatctgttcaaccaggccgcgggc
gggcgactgatgcaaacccgcgtcgattcggcgggtaccacgctgttcgcgcatgcggtc
gcggccgacggcggcggcgtgcgcctcatcctcgtgaataccgatgcgaacagcggctat
gacgtcgccgtcgattgcagcagcgtgccgaacgcgcgcgccggcatcgtcacgacgctc
ggcgggccgtcgctcggcagcctgacgggcacgcagatcgacggcgcgacgtttgcgctc
gacgggagcggggcgccgcagggcggccggccggtcgcttgcgtgaacggcgtgctcggc
gtgcatgtcgcgtccgcgagcgcgttgctggtcgacttcgcgtga

DBGET integrated database retrieval system