KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1581Help
Entry
BURPS1106A_1581   CDS       T00480                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_30
Motif
Other DBs
NCBI-ProteinID: ABN90926
UniProt: A3NU31
Position
I:1533546..1534523
Genome map
AA seq 325 aa AA seqDB search
MAAEWMGCDRFRANSMKVSLRHLRAFVAVAREGSFTAAAGALCLTQSTLTKTIREFEQAL
GVHVFERNTRRIALTPYGAAFLVDAVRILNDLDLALDGVNQQLLGNSGTVRVASGLAFAS
TVMPCVIRALHAQEPGIHVDLLDDTSGGVIRRIESGEVDVGIGSYVGMAGNALSVRRLLS
ARLGVLFPVGYPKIPSRPTLASLNEIPILRDSDESSIAAAFRQQAPDLWERMRRKVSVTN
LDLQLALVREGIGACIVSALAASHPSARGMPYRLLVEPEMTRDVYVFTRRDVSLLPAAAR
FVDILMNVLPSIDFAEGVELACDGA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgaatggatgggctgcgaccggtttcgcgcaaattcgatgaaagtatcgctg
cgtcatttacgtgcgttcgtggcggtggctcgggaaggcagcttcacggccgccgcgggc
gcgctgtgcctcacgcagtcgacgctgacgaagacgatccgcgagttcgaacaggcgctc
ggcgtgcacgtgttcgagcgcaatacgcggcgcatcgcgctcacgccgtacggcgcggcg
ttcctcgtcgacgcggtgagaatcctgaacgacctcgatctcgcgctcgacggcgtcaac
cagcaactcctcggaaacagcggcaccgtacgcgtcgcaagcggcctcgcgttcgcgtcg
acggtcatgccgtgcgtgatccgggccttgcacgcgcaggagcccggcattcacgtggac
ttgctcgacgacacgagtggcggcgtgatccggcggatcgaatccggcgaggtcgacgtg
gggatcggctcgtacgtcggcatggccggcaacgcgctgagcgtgaggcgcctcctgagc
gcgcgtctgggcgtgctgtttccggtcggctatccgaagattccgtcgcggcccacgctc
gccagcctgaacgagattccgatcctgcgcgactcggacgagtcgagcatcgccgccgcg
ttccggcagcaggcgcccgatctctgggagcggatgaggcgaaaggtgtccgtcacgaat
ctcgatttgcagctcgcgctggttcgcgagggcatcggcgcgtgcatcgtgtcggcattg
gcggcgtcgcatccgtccgcgcgggggatgccgtatcgcctgctcgtcgagccggaaatg
acgcgggacgtctatgtgttcactcgccgcgacgtgtcgctgctgccggccgccgcgcgg
ttcgtcgacattctgatgaacgtgcttccgtcgatcgatttcgccgagggcgtcgaactc
gcttgcgacggcgcgtga

DBGET integrated database retrieval system