KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1593Help
Entry
BURPS1106A_1593   CDS       T00480                                 

Definition
(GenBank) H-NS histone family protein
  KO
K03746  DNA-binding protein H-NS
Organism
bpl  Burkholderia pseudomallei 1106a
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bpl03036]
    BURPS1106A_1593
   03400 DNA repair and recombination proteins [BR:bpl03400]
    BURPS1106A_1593
Chromosome and associated proteins [BR:bpl03036]
 Prokaryotic Type
  Nucleoid associated proteins
   HNS (histone-like nucleoid structuring protein)
    BURPS1106A_1593
DNA repair and recombination proteins [BR:bpl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      BURPS1106A_1593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone_HNS
Motif
Other DBs
NCBI-ProteinID: ABN91780
UniProt: A3NU43
Position
I:1544184..1544528
Genome map
AA seq 114 aa AA seqDB search
MDHDPQLTERWLEIHAEIEALRRKAKAAAIMQIELLMTQYGISPGELKGVDGAPAHRKPK
ARYWNPETGQTWSGRGRMPKWLVGRELASHLIDGESALKRMKLLNRDAQDADEG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgatccgcaactgaccgaacgatggctggagatacatgccgaaatcgaagcg
ttgcgccgcaaggcgaaggcggcggcgatcatgcagatcgaactgctgatgacgcaatac
ggcatctcgccgggcgaactgaagggcgtcgacggtgcgccggcgcatcgcaagccgaag
gccaggtactggaatccggagacggggcagacgtggtcggggcgcggccggatgccgaaa
tggctggtcggaagggagctcgcttcccatttgatcgacggcgaatccgcgctgaagcgg
atgaagctgctgaaccgcgacgcgcaggacgcggacgaagggtga

DBGET integrated database retrieval system