KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1609Help
Entry
BURPS1106A_1609   CDS       T00480                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2235
Motif
Other DBs
NCBI-ProteinID: ABN89078
UniProt: A3NU59
Position
I:1560574..1562883
Genome map
AA seq 769 aa AA seqDB search
MACCKTLHIGIFFDGTRNNADRDRGARTESNVARLYAAFPIDKYHQAIYVAGVGTPFVEQ
IGDFGVGLQAAAGAAAGWAGEGRINWALLRIHDILHAYVHGQTLTAVLGKRYEELVKSMS
LDMNFKGIDLGGTPPKPGSFGDIKLRANSGVGALKLIAAEQNGVELTWDLDTNWAQLKNE
LDSSKWNAAVQEWDAKRRKVLLDRRAQLKARIGDLLVKGKPKLQRIRLYVFGFSRGAAEA
RTFSNWLADALDPDFSLCGVPVSYDFLGIFDTVASVGIAQSAAATLFDGHGGWGRKELMA
VPHYVRRCVHMVAAHEPRGSFPLDLIDCSMDGREEIVYPGVHSDVGGGYGPGEQGRGRDD
ADKLSQVPLLDMYREARKAGVPLDINGPGIGADVIAAFKVSAGLKQAFAAYVKKSENYYY
EKDHGTPGLMRCHYGLYLRWRKMRLKDMHAQPSFKAAQARYPQDAADLDSANAELKEEWN
DLLEVEKAGGPTITRYVEKFVTKWASENPKTAAVVSTSLLPAAVAAEVFVPGVSAATVLF
GDKVVKLVQAQLKEKWEQWLQVRSDWNMGPPEPAISALYDNYMHDSRAWFKPLGDDDDVW
NHRQIQELKTKQASFERAHAAWKKRVEMGMPSLLQVTQAMGVGSTGWGPVGGLPPEPEPR
SPLTAQQADLLKRYDAAMQSAKQARAAKDPNAPTDSAVLTDPKVTGGLALQTSGREFYFL
WGFLRWRTVFVNGVRWDQPRVPTVQEEMEGMRMQMQRQVDMKGIGVLFQ
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggcttgttgtaagacattgcatatcggaatcttctttgatggtacgcgtaacaacgct
gatcgggataggggggcgcgaacggaaagcaatgtggcacggctttatgccgcttttcca
atagataaatatcaccaagcgatttacgttgctggagttggcacgccttttgtcgagcag
attggtgatttcggtgttggcttacaggcggccgcaggagctgcggcaggttgggcggga
gaggggcgaattaactgggctttgcttcggattcacgatattttgcatgcgtatgttcac
ggtcagacgttaacggcagtgttaggaaagcgctacgaggaactcgtaaaatcgatgagc
ctcgatatgaattttaagggcatcgaccttggcggaacgccgcctaaaccgggaagcttc
ggcgatatcaaattgcgtgccaattctggtgtgggggcgctcaagctgattgctgccgaa
cagaatggtgtcgagctgacttgggatttagatacgaattgggcgcagctcaaaaacgag
ttggattcgtcgaagtggaatgcagccgtgcaagaatgggacgccaagcgccgtaaggta
ttgctcgatcgtcgtgctcagctaaaagcgcgcatcggtgatctgctggtcaaggggaag
ccgaagctgcaacgcattcggctatacgtattcggcttttcgcgcggtgcagcggaggct
cgcactttctcgaactggcttgctgacgcgcttgaccccgatttcagtttgtgtggagtg
ccggtttcatacgattttctcggtatctttgatacggtcgcatcggtcggcatcgctcag
agcgccgccgcaacattattcgacggacatggaggatgggggcgcaaggaactgatggcc
gtgccgcattatgtgcgccgttgcgtgcacatggtggcggcacatgaacctcgtggatca
tttccgctcgaccttatcgattgttcgatggacggtcgtgaggagattgtctacccgggt
gttcactcggacgtcggcggcggctatgggccgggcgaacaggggcgcggtcgggacgac
gccgacaaactttcgcaagtcccgctgcttgatatgtaccgggaggcgcgtaaggcaggt
gtgcccttggatatcaatgggccaggtatcggcgcggacgtcatcgctgcattcaaggtt
tcagcagggctaaaacaagccttcgcagcctacgtaaaaaagagcgagaactattattac
gagaaagatcacggcacgccgggcctaatgcgttgccattacggcttgtatctccggtgg
cgcaagatgcggctcaaggacatgcatgcacagcccagcttcaaggctgcgcaggcgcgc
tatccgcaagatgcagcggatctggacagtgcgaacgcggaattgaaggaggagtggaac
gatttgctggaggtcgagaaagctggcggcccgacaatcacccgatacgtggagaagttt
gttacgaaatgggccagtgagaatccgaaaacggccgccgtcgtttccacgtctctactt
ccggccgcggtcgctgctgaggtttttgttccgggggttagcgctgcgacggttctattc
ggcgacaaagtggtgaaactggtgcaagcccaactcaaggagaagtgggagcagtggctg
caagttcgcagcgactggaacatggggccgcctgaacctgcgatcagcgcactctacgac
aactacatgcacgactcccgcgcatggttcaagccgctcggcgacgatgacgacgtgtgg
aaccataggcagattcaggaactcaagaccaagcaagccagctttgaacgcgcccatgct
gcctggaaaaagcgtgtcgaaatgggcatgccaagcttgttgcaggttacacaggcaatg
ggcgtaggttccacaggatgggggcccgtcggcgggcttccgcccgaacccgaaccccgc
tccccgctcaccgcccagcaagccgatctgctcaagcgctacgacgccgcgatgcagtcc
gccaagcaggcacgcgccgcaaaggacccgaacgcgccgacggacagcgccgtgctgacc
gatccgaaggtgacgggcggcctcgcgctgcaaaccagcggccgcgagttctatttcctg
tggggcttcctgcgctggcggaccgtgttcgtgaacggcgtgcgctgggaccagccgcgc
gtgccgacggtgcaggaggaaatggagggcatgcgcatgcagatgcaacgccaggtcgac
atgaagggcatcggcgtactgttccaatga

DBGET integrated database retrieval system