KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1610
Entry
BURPS1106A_1610   CDS       T00480                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BURPS1106A_1610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpl02044]
    BURPS1106A_1610
Secretion system [BR:bpl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1106A_1610
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1 DUF4157 Lipoprotein_21
Other DBs
NCBI-ProteinID: ABN88667
UniProt: A3NU60
Position
I:1562992..1566327
AA seq 1111 aa
MDLVAALTGYSQTTRHIRIDTAMPGAFVVERFHGREGVNESFRFEIDVLSSEPFLDLTPL
IGHAARLRLATGAGERSWNGYVTHAAYADSDGEITRYRLTMESWLALLRLRRNCLYFVDV
DTKDICERVFGDYPQARWRYELKEPLRKFSLRGQYRETDDTFVLRQLAEAGLSFRIEHAQ
DAGKEASGDHTVVVFDRRAPFRHGSTIAYNLQDVGDPDGVITQFSERHQMVPDRVVATSW
KADELLALAGHAQQPPEDKAPVLPVREIYDGQRAGRFDTIDDAQRFAEQRLDALRLPKRI
HYGAGSSRTLEIGAVHTLAGYLDRAITFVPLSIEHEAVNNLGADIGALLGRGELDKGLYR
NRFVAVPDGTPIVPPHRDRPIVHGVQTAIVVGEAGSRVSSTRDHQVRVQFPWMRGTAPLP
GGLTDTASRSNPAGHAPGDHRSGVLARVAESSAGPNFGHAFTPRVGAEVVIGFESGNIDM
PVVLGQVYGGRVQPPFAAGEGSDANHPGTLTGLQTQTLDGQSGSRWVMDDAAGQLRHELS
NSTANSRLAQGYLIDQQGAMRGAYRGEGFELATDGWGVVRAGEGVLVSSTARRLATSTQM
DVAQSVGQLKQAVRTAQGMSESAAAAHAGGLAANAAQADFLKAIDPAQDGKYTGAVNGQS
ATKASGAQRDGGEPVERFAAPAVLMESPENIVLTTPHSAVSYAAQHVHLTAQRDAHVAAA
ATVAAASGDAVSLYAAAGGLRAIASDGPVSVEAHTSTMEILADQSVRITSTDDRIDVLAK
DAIVLQQGPNRITLKGGDITVETPGQFLVKSGAHPFPGPAAQSVSLPPLPIPAPLALFDE
QIRFVNEDGEPLGNVAYQLKLADGSTVSGVTDDNGRTERVSTDEPTAIQSATLTPTQVVD
CCGRTSDVPPPAVKVDIKGVGTHDTLVGSSEQSVTVKGESRPLTDGEIEMAKTVFQDSID
YSAVRVHKGSYFWFNLQSKRTAVTPNNTMYFREEDFVEDFSVVSEEYPRRGWFMHEMTHV
WQHQRGYAVRWHALTVTIRGESAYRYEIEPGQVFSDFNMEQQGNLVSDYFALVVVDNRGE
LIHAQPGSKNQLRQVLAPLLQDPKDASNLPK
NT seq 3336 nt   +upstreamnt  +downstreamnt
atggatttagtcgccgcattgacgggctattctcaaacgactcgccacatccggatcgac
acggcgatgccgggcgcgttcgtggtcgaacgtttccatgggcgcgagggcgtcaacgaa
tcgtttcgcttcgagatcgacgtgctgtcgagcgagccgtttctcgatctgacgccgctc
atcggccacgcggcgcggctgcgtctcgcgacgggcgcgggcgagcgcagctggaacggc
tatgtgacgcatgcggcgtatgcggacagcgacggcgagatcacccgctatcgcctcacg
atggagtcgtggctcgcgctgttgcgcctgcgtcgcaattgcctgtacttcgtcgacgtc
gacacgaaggacatctgcgagcgtgtgttcggcgattatccgcaagcgcgttggcgctac
gaactgaaggaaccgctgcgcaagttcagcctgcgcggccagtaccgggagaccgacgac
acgttcgtgctgcgccagctcgccgaagccggcctgtcgttcaggatcgagcatgcgcag
gatgcgggcaaggaagcgtcgggcgaccatacggtcgtcgtgttcgatcggcgcgcgcca
tttcggcacggcagcacgatcgcatacaacctgcaggacgtcggcgatccggacggcgtg
atcacgcagttttccgaacgccatcagatggtgccggaccgggtcgtcgcgacgagctgg
aaagccgacgaattgctcgcgcttgccgggcacgcgcagcagccgcccgaggacaaggcg
ccggtgctgcccgtgcgcgaaatctacgacggccaacgcgcgggccgcttcgacacgatc
gacgacgcgcagcgcttcgccgagcagcggctcgacgcgctgcgcctgccgaagcggatc
cattacggcgcgggctcgtcgcgcacgctcgagatcggcgcggtccatacgctcgccggt
tatctggaccgtgcgatcacgttcgtgccgctgtcgatcgagcacgaggcggtcaacaat
ctcggcgccgacatcggcgcgctgctcgggcgcggcgagctcgacaaggggctgtaccgc
aaccgtttcgtcgcggtgcccgacggcacgccgatcgtgccgccgcatcgcgatcggccg
atcgtgcacggcgtgcagaccgcgatcgtcgtcggcgaggccggcagccgcgtcagcagc
acgcgcgatcatcaggtgcgcgtgcagtttccgtggatgcgcggcacggcgccgctgccc
ggcggcctgaccgacacggcgagccgctcgaatccggccgggcacgcgccgggcgatcat
cgctcgggcgtgctcgcgcgcgtcgcggaatcatcggccgggccgaacttcgggcatgcg
ttcacgccgcgcgtcggcgccgaagtggtgatcggcttcgagtcgggcaacatcgacatg
cccgtcgtgctcggccaggtctacggcgggcgcgtgcagccgccgttcgcggcgggcgaa
ggcagcgacgcgaaccatccgggcacgctgaccggcctgcagacgcaaacgctcgatggc
cagtccggcagccgctgggtaatggacgacgccgcgggacaactgcggcacgagctgagc
aactcgaccgcgaacagccggctcgcgcagggttacctgatcgatcagcagggcgcgatg
cgcggcgcgtatcgcggcgaaggcttcgagctcgcgaccgacggttggggcgtcgtgcgc
gcgggcgaaggcgtgctcgtatcgagcacggcgcggcggctcgcgacgtcgacgcagatg
gacgtcgcgcaaagcgtcggacaactgaagcaggcggtgcggaccgcgcagggcatgagc
gaatccgccgccgcggcgcacgcgggcgggttggccgccaatgccgcgcaggcggatttc
ctgaaggcgatcgatccggcgcaggacggcaagtacacgggcgcggtcaacgggcagagc
gcgacgaaggcgagcggcgcgcagcgcgacggcggggagccggtcgagcgcttcgccgcg
ccggccgtgctgatggagtcgccggagaacatcgtgctgacgacgccgcacagcgccgtc
tcgtatgcggcgcagcacgtgcatttgaccgcgcagcgcgacgcgcacgtagcggccgcc
gcgacggtcgcggccgcgtcgggcgatgccgtgagcctgtatgccgccgcgggcggcctc
cgggcgatcgcgagcgacgggccggtgagcgtcgaggcgcatacgtcgacgatggagatt
ctcgcggatcagtcggtgcgcatcacgtcgaccgacgatcgcatcgacgtgctcgcgaag
gacgcgatcgtgctgcagcaggggccgaaccggatcacgctgaagggcggcgacatcacg
gtcgagacgccggggcagttcctcgtgaagtcgggcgcgcatccgtttccggggccggcc
gcgcagagcgtttcactgccgccgctgccgattcccgcgccgctcgcgctgttcgacgaa
cagattcgcttcgtcaacgaagacggcgagccgctcggcaacgtcgcgtaccagctgaag
ctcgccgatggctcgaccgtgtcgggcgtgaccgacgacaacggcagaaccgagcgcgta
tcgacggacgagccgacggcgatccagtcggcgacgctcacgccgacgcaggtcgtcgac
tgctgcgggcgaacttcggatgtgccgccgccggcggtgaaggtcgacatcaagggcgtc
ggcacccacgacacgctggtgggcagctcggagcaatcggtcacggtcaagggcgagagc
cggccgctgaccgacggcgagatcgagatggcgaaaaccgtgtttcaggacagcatcgat
tacagcgcggtgcgcgtgcacaagggcagctatttctggttcaacttgcagagcaagcgt
acggccgtgacgccgaacaatacgatgtatttccgcgaagaggatttcgtggaggatttt
tcggttgtcagcgaggagtatccgaggcggggttggttcatgcacgaaatgacgcacgtt
tggcaacatcaacgaggatatgccgtgcgctggcatgcgcttaccgtgacgattcgcggc
gagagcgcgtatcggtacgaaatcgagcccgggcaagtcttcagcgatttcaatatggag
cagcaaggcaatcttgtatcagactactttgcgctcgttgtcgtggacaatcgaggtgaa
ttgattcatgcgcaaccaggaagcaagaatcaacttcgccaagtgctggccccacttcta
caggatcccaaggatgcatcgaatcttccgaaatag

DBGET integrated database retrieval system