KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1615Help
Entry
BURPS1106A_1615   CDS       T00480                                 

Definition
(GenBank) Rhs element Vgr protein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Sarcoglycan_1
Motif
Other DBs
NCBI-ProteinID: ABN90892
UniProt: A3NU65
Position
I:1568463..1571303
Genome map
AA seq 946 aa AA seqDB search
MSIPTDVLQALFGGWSQHDRFLWITTPLGANALVAESLHGWEALDDGGFRLQLTALAEHP
SLPLAQLIGAPILIEWQAQEGRDARRPFHGHVIAAELVGYNGGLARVRLVVEPWLTLLRQ
RVDSYNYLDASVVEISEQVFRRYARGAIAPAWRWALADAAKYPKRSLTAQAGESDFDFLE
RLWAEEGIFYWFEHEGDARASSLGKHTLVLADSNQRFAPDEPEIVGFHQTSDDDPQGCIQ
HFVHARRWRIGSVARASWDHRSLSTRPTGARANGAVAPGEDRDVAGPYAYQTGAIGDRRA
QQQLDAQRVAALRSEGRSTRRDLRPGLRFAIAHHPTLGVSDAFICLRVEHSARANVDATV
RSAIEQRLGAIASIAGAAPVPHGPASALNAALGADTHHGGSLMRDDAVYRNRFVALPAEQ
TYRPLAASGHGARMHPVAVMPGAQTAIVVGAGDPVHTDRDHRIRIQHHAQRGENAASRDD
HPHAANAPANRGAGTWTRMMTPVGGDNWGGVSVPRVGQEVWTEWLEGQPDRPVAVAALYN
GRGNAHAQHNAQAGGPSGSTGNAAAWFAGNAHAAVLTGFKTQDMSMSQQGTGGYRQFMLD
DTAGQSSARLYTTDRNSGLTLGHVKQTQDNRRQADRGYGAELATDAAGALRGGAGLLIST
APGVSQMDASAPSQVLAQHRQTLQSLAALAHKQGAEPGGAVPEAAGGAGAASASTGAAAD
KPLPAVDGIEQSREAIGATREGSGGDTAGGGGGGAIAWSKPHLVAHGEAGLAAMSAKSHV
WVSGTETVLSAGQDVQLTAKGKTSVVANHGISLYTQGAAGDGRPVAGRGIALHAASGAVS
VQAQNAGKLSASAQKAVTLASAQGSASVQAQQRVLLSAAKAYLKMEGNDIVVGAPGRADF
KAAAHQLTGPKSAGASAQMPKSEPKLCEYKTRAADVAHEGTMKSAA
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccccactgacgttctgcaagcactcttcggcggctggtcgcaacacgaccgc
tttctctggatcacgacgccgctcggcgcgaacgcgctcgtcgcggaaagcctgcacggc
tgggaggcgctcgacgatggcggcttccgtttgcagctcaccgcgctcgccgagcatccg
tcgctgccgctcgcgcaactgatcggcgcgccgatcctgatcgaatggcaggcgcaggaa
gggcgcgacgcgcgccggccgttccacggccacgtgatcgccgccgagctcgtcggctac
aacggcggcctcgcacgcgtgcggctcgtcgtcgagccgtggctcacgctgctgcggcag
cgcgtcgacagctacaactatctggacgcgagcgtcgtcgagatcagcgaacaggtgttc
cgccgttacgcgcgcggcgcgatcgcgcccgcatggcgatgggcgctcgccgatgcggcg
aagtacccgaagcgcagcttgaccgcgcaagccggcgagtccgatttcgacttcctcgag
cggctctgggcggaggagggcatcttctactggttcgagcacgaaggcgacgcgcgcgca
tcgagcctcggcaagcacacgctcgtgctcgccgattcgaatcagcgcttcgcgccggac
gaaccggagatcgtcggctttcatcagacgagcgacgacgacccgcaaggctgcatccag
cacttcgtgcacgcgcggcgttggcgcatcggcagcgtcgcgcgcgcgagctgggatcac
cgcagcctgtcgacgcgtccgacgggcgcgcgcgcgaacggcgcggtcgcgccgggcgag
gatcgcgacgtcgcgggcccgtacgcataccagacgggcgcgatcggagaccggcgcgcg
cagcagcaactcgacgcccagcgcgtggccgcgctgcggagcgaaggccgcagcacgcgc
cgcgatctgcggcccgggctgcgttttgcgatcgcgcatcatccgacgctcggcgtatcg
gatgcgttcatctgcctgcgcgtcgagcattcggcgcgcgcgaacgtcgatgcgaccgtg
cgcagcgcgatcgaacagcgcctcggcgcgattgcgtcgatcgccggcgccgcgccggtg
ccgcatggccccgcgagcgcgctgaatgcggcgctcggcgccgatacgcatcacggcgga
tcgctgatgcgggacgacgccgtctatcgcaatcgcttcgtcgcgttgcccgccgagcag
acgtatcggccgctcgccgcatccggccatggcgcgcgcatgcacccggtcgccgtgatg
ccgggggcgcagacggcgatcgtcgtgggcgcgggcgatcccgttcacaccgaccgggat
caccggattcgaatccagcaccacgcgcagcgcggcgagaatgcggcgagccgcgacgat
cacccgcatgcggcgaacgcgccggcgaaccgtggcgcgggcacgtggacgcggatgatg
acgcccgtgggcggcgataactggggtggggtgagcgtgccgcgcgtcgggcaggaagtg
tggaccgaatggctcgaaggccagcccgaccggccggttgcggtggccgcgctctacaac
ggccgcggcaacgcgcacgcgcagcacaacgcgcaggcgggagggccgagcggcagcacc
ggcaatgcggccgcatggttcgccggcaatgcgcatgcggcggtgctgacgggtttcaag
acgcaggacatgagcatgagccagcaaggcacgggcggctatcggcaattcatgctcgac
gatacggcgggccagtcgagcgcgcgcctgtacacgacggaccgcaacagcgggctcacg
ctcgggcacgtgaagcagacgcaggacaaccggcgccaggccgatcgcggctatggcgcg
gaactggcgacggatgccgccggcgcgctgcgcggcggcgcggggctcttgatcagcacg
gcgcccggcgtgagccagatggatgcgagcgcgccgagccaggtgctcgctcagcatcga
cagacgttgcaaagcctcgcggcgctcgcgcacaagcagggcgcggagccgggcggtgcg
gtgcccgaggcggcgggcggagcgggcgcggcgtcggcgtcgacgggggcggcggcggac
aagcctttgccggccgtcgatggcatcgagcagagccgtgaagcgatcggcgcgacgcgt
gaaggaagcggcggcgatacggcaggcggcgggggcggcggcgcgattgcgtggagcaag
ccgcatctcgtcgcacacggcgaggcggggctggccgcgatgtcggcgaagagccacgtg
tgggtgtcgggtaccgagacggtgttgagcgccggacaggacgtgcaattgacggcgaag
ggcaagacgagcgtcgtcgcgaatcacggcatctcgctgtatacgcagggcgcggcgggc
gacgggcggccggttgccggccggggcatcgcgttgcacgcggcgtccggcgcggtgagt
gtgcaagcgcagaacgccggcaagctgagcgcgagcgcgcagaaggcggtgacgctcgcg
agcgcgcaaggcagcgcgtccgtgcaggcgcagcagcgcgtcctgctgagcgcggcgaag
gcctatctgaagatggaaggcaacgacatcgtcgtcggcgcgccggggcgcgcggatttc
aaggcggcggcgcatcagttgacggggccgaagagcgcgggggcgtcagcgcaaatgccg
aagagcgaaccgaagctgtgcgagtacaagacgcgcgcggccgacgttgctcacgaaggc
acgatgaagtcggcggcttga

DBGET integrated database retrieval system