KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1616Help
Entry
BURPS1106A_1616   CDS       T00480                                 

Definition
(GenBank) hypothetical protein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4123
Motif
Other DBs
NCBI-ProteinID: ABN89758
UniProt: A3NU66
Position
I:1571305..1572180
Genome map
AA seq 291 aa AA seqDB search
MVAFDLDSRNFLAFQYAVINPLQVDEEAWADLETVPLVPDRYREQVHLFPRLVSLTPLEA
NARADLLARAQQWDREYDDPYFSTLLHTTKDIDFIRTHLIAQMEQYHLARREYDVIRLHD
PKVLRHLSWLLSADQWESLLGPIEAWAWREPDGTWWYRERDVRVTDVPSRMRLSPEQWTT
LLRFGEINQTLMLLSRAAPDLVDDASLAQRLNALLADAWNIHRLTDRSDRILYAIQAIRF
HPRIHDHPEMRRRLRQPHDDDSSYADRCDDLDDATMQRVVDEMNHPYKEHV
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcgttcgatctcgactcgaggaattttctggcgtttcagtacgcggtgatcaac
ccgttgcaagtcgacgaagaggcttgggcggaccttgagaccgtaccgcttgttcctgat
cgctaccgggaacaggtgcatctttttccacgcctagtcagtttgacgccgttggaggcg
aacgcgcgggccgacctgctggcgcgcgcgcagcaatgggaccgcgagtacgacgacccg
tatttctccacgctgctccatacgacgaaagatatcgatttcatcaggacgcatctgatc
gcccaaatggagcaataccatctcgcccgtcgcgagtacgacgtgattcggctgcacgat
ccgaaagtcctgcgccatttgagctggctgctgagcgcggatcaatgggaaagtctgctt
gggccgattgaggcgtgggcgtggcgcgaacccgatgggacgtggtggtatcgcgagcgc
gacgtgcgcgtgacggatgttccttcccggatgcgactgtcgccggaacaatggacgacg
ttgctgcgcttcggcgagatcaatcaaacgctcatgctgctgtcgcgggccgctcctgac
ctggtcgacgatgcgagtcttgcgcagcgtcttaacgcgctgctagcggacgcgtggaat
atccaccgcctcacggaccgctcggaccgaatactgtatgcaatccaggcgattcgcttt
catccgcgtatccatgaccatcccgagatgcgcaggcggctgaggcagccgcacgacgat
gactcatcctatgccgatcgctgtgacgatctcgacgatgcgaccatgcaacgcgtggtc
gacgaaatgaaccatccatacaaggaacatgtatga

DBGET integrated database retrieval system