KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1620Help
Entry
BURPS1106A_1620   CDS       T00480                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABN91063
UniProt: A3NU70
Position
I:complement(1576982..1577161)
Genome map
AA seq 59 aa AA seqDB search
MHGKGRRRCDATDVTLVMIENPPSILATVRADNPGGIATTVAPLVGDAMAQWIGAPSHS
NT seq 180 nt NT seq  +upstreamnt  +downstreamnt
ttgcacggtaaagggcgtcgacgttgcgatgcgactgacgtcacgctcgtcatgattgag
aatcccccctcgatactcgcgaccgttcgggcggacaatccggggggtattgcgacgacg
gtcgcgccgctcgtcggcgacgcaatggcgcaatggatcggagcgccgtcgcacagctag

DBGET integrated database retrieval system