KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1624Help
Entry
BURPS1106A_1624   CDS       T00480                                 

Definition
(GenBank) amidohydrolase family protein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: ABN90347
UniProt: A3NU74
Position
I:complement(1578812..1579795)
Genome map
AA seq 327 aa AA seqDB search
MDQASNDPAVETTGRPFATRTYEARKAHEAREAHDKRAPLVDAWYGSGAAPIEAVDSHAH
VFLRSLPRIPSARHSPEYDATLESYVAHLSACGITHAVLVQPSFLGTDNHFFVDALARYP
QRFRGIAVVNPCTAEDEFARLEATDVVGIRLNLVGLPIPDFTAPRWRALLARANALGWHV
EVHRRAADLPAIIPALLDQSCRVVVDHFGRPAPHLGTLDPGFRFLLSIAGTGQVWVKLSA
AYRNIGSGDGTAFGTRAARALLGAFAPNRLVWGSDWPHTQHRDRTDYQTTRSALDDWVPD
PSLRRIILCDSARALFRFDRQTPARDT
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggcatcgaacgatccggcagtcgaaacgacaggccgccccttcgccacgcgc
acgtatgaggcacgaaaggcacatgaggcacgtgaggcgcacgacaagcgcgccccgctc
gtcgacgcatggtacggcagcggcgccgcgccgatcgaggccgtcgattcgcatgcgcac
gtgttcctgcgcagcctgccgcgcatcccgagcgcgcggcactcgccggaatacgacgcg
acgctcgaatcgtacgtcgcgcatctgagcgcatgcggcatcacgcatgccgtgctcgtg
cagccgagttttctcggcaccgacaatcacttcttcgtcgatgcgctcgcgcgctatccc
cagcgctttcgcggcatcgcggtcgtgaacccctgcaccgccgaggacgaattcgcgcgg
ctcgaggcgacggacgtggtcggcatccgcctgaatctcgtcggcctgccgattccggat
ttcaccgcgccgcgctggcgcgcgctgctcgcgcgcgcgaacgcgctcggctggcatgtc
gaagtgcaccggcgcgcggccgatctgccggcgatcattcccgcactgctcgatcaatcg
tgccgtgtcgtcgtcgatcatttcgggcggccggcaccgcacctcggcacgctcgatccg
ggcttccggttcctgctgtcgatcgcgggcacgggacaagtatgggtcaagctatccgcc
gcgtatcgcaacatcggctcgggcgacggcaccgcgttcggcacgcgcgcggcgcgcgcg
ctgctcggcgcgtttgcgccgaaccggctcgtctggggcagcgactggccgcacacgcag
catcgcgatcggaccgattaccagacgacgcgctcggcgctcgacgactgggtgcccgat
ccgtccctgcggcgcatcatcctctgcgactcggcgcgcgcgctgttccgcttcgatcgc
cagacgcccgcgcgcgatacatga

DBGET integrated database retrieval system