KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1626Help
Entry
BURPS1106A_1626   CDS       T00480                                 

Definition
(GenBank) hypothetical protein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABN91488
UniProt: A3NU76
Position
I:1581412..1581540
Genome map
AA seq 42 aa AA seqDB search
MKILDPHSSIWGERGMKACIRQSARRFGGAAASVEKQSHCAE
NT seq 129 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattctcgatccgcattcgtctatttggggcgagcgcggaatgaaagcgtgtatt
cgccaatcagcccgccgattcggcggcgcggcggcgagcgtcgaaaagcagtctcattgc
gccgagtga

DBGET integrated database retrieval system