KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1631Help
Entry
BURPS1106A_1631   CDS       T00480                                 

Definition
(GenBank) hypothetical protein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABN92540
UniProt: A3NU81
Position
I:1583081..1583266
Genome map
AA seq 61 aa AA seqDB search
MAARDALPFAHARPQQARRVAQGVGTGIWRAWRRGPRASIGSSKNNNEINGRSCGERNAQ
A
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcgcgcgatgcgctgccgttcgcccatgctcgtccgcagcaagcgcgacgcgtt
gcgcagggcgtcggtacgggcatctggcgcgcgtggcgacgggggccgcgcgcgtcgatt
ggatcatcgaaaaacaacaacgagatcaacgggcgatcgtgtggagagcgcaatgcacaa
gcgtga

DBGET integrated database retrieval system