KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1635Help
Entry
BURPS1106A_1635   CDS       T00480                                 

Definition
(GenBank) fimbrial chaperone protein
  KO
K07346  fimbrial chaperone protein
Organism
bpl  Burkholderia pseudomallei 1106a
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bpl03110]
    BURPS1106A_1635
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpl02044]
    BURPS1106A_1635
   02035 Bacterial motility proteins [BR:bpl02035]
    BURPS1106A_1635
Chaperones and folding catalysts [BR:bpl03110]
 Other chaperones and cochaperones
  PapD
   BURPS1106A_1635
Secretion system [BR:bpl02044]
 Chaperone-usher system
  Type 1 pilus assembly protein
   BURPS1106A_1635
Bacterial motility proteins [BR:bpl02035]
 Pilus system
  Fimbrial proteins
   BURPS1106A_1635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PapD_N
Motif
Other DBs
NCBI-ProteinID: ABN88971
UniProt: A3NU85
Position
I:1585030..1585869
Genome map
AA seq 279 aa AA seqDB search
MKVSRSPGAPARAARALRCALLGAAAAAPFVAQHAHAAASVMIWPIDPVIESGDRAAALW
LENRDRRPVTLQVRVLGWREANGEDVYDEDQPRVAGSPPMATVEPGKRQLIRLTRLADTA
PGTEQAYRVLIDEIPQPDDDAQPAASGTSLGVKFQMHYSVPLFVYGDGLWTKEHPDRRRD
PATAGRPALRWRVEHDGGKRWLVVSNRGPVHARITHAAFEASGARADFARGLLGYVLPGA
RMRWALPETLKLHSNSKLIATVNGVADLAIDVDGAASNR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttcgagatcgcccggcgcgccggcgcgcgcggcaagggcgctgcgctgcgcg
ctgctcggcgcggccgccgccgcgccgttcgtcgcgcagcacgcgcacgcggcggcgtcc
gtgatgatctggccgatcgatcccgtgatcgaaagcggcgaccgggcggcggcgctctgg
ctcgagaaccgcgatcgccggccggtgacgctgcaggtgcgcgtgctcggctggcgcgag
gcgaacggcgaggatgtctacgacgaggatcagccgcgcgtggccggcagcccgccgatg
gcgacggtcgagcccggcaagcgccagttgattcgcctcacgcggctcgcggatacggcg
cccggcaccgagcaggcgtatcgcgtgctgatcgacgagatcccgcagccggacgacgac
gcgcaacccgccgcgagcgggacgtcgctcggcgtgaagttccagatgcactactcggtg
ccgctcttcgtctacggcgacggcctgtggacgaaagagcacccggacaggcgccgcgat
ccggcgacggcggggcggcccgcgctgcgctggcgcgtcgagcacgacggcggcaagcgt
tggctcgtcgtgtcgaatcgcggccccgtgcatgcgcgcatcacgcacgcggcgttcgaa
gcgagcggcgcgcgcgccgatttcgcgcgcggcctgctcggctacgtgctgcccggcgcg
cggatgcgctgggcgctgcccgagactctcaagctccattccaattccaagctgatcgcc
acggtcaacggtgtggccgatctcgcaatcgacgtggacggcgccgcttcgaatcggtaa

DBGET integrated database retrieval system