KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1639Help
Entry
BURPS1106A_1639   CDS       T00480                                 

Definition
(GenBank) response regulator/sensor histidine kinase
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg HisKA HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ABN89264
UniProt: A3NU89
Position
I:1589717..1591798
Genome map
AA seq 693 aa AA seqDB search
MKSDGFCGGKFCRRILVCLCAAALAFLTLPQLSNRMQESMLIATEPCKWTHVYPVLWGSH
VLVALLSYGWAHRDLKRLQAALRASRGSLATASHELRAPVNGMLALVELVRQGLLAPEQQ
RLLGLVQDSGQSLARVLNDILDHASIEAGQFAIEKTRVDVRELVDSVSAMLAVHAHRKGL
RLRLHVDANVPAAVLTDGNRLRQILVNLIGNGIKYTERGGVSVRVRAADDVDGMVELVAT
IVDTGIGIAADELRRLFTPFARATRGARRMESGTGLGLAIARKLARLLGGDVTLTSDEGR
GTTATARIRCAVAARGYANDALAGRVVSIDVGDAALAATLAAYARAAGVRVAARGAPDVE
AVLCDDARVDASRTQLGWVGVTDAPALAGWTDSGTHVRLSSNPLGWRAFIDGLRAALDAR
DARDAAGAHTAARAEPGAYRVLVVDDQEMNRIVLRYQLDALGHHARLCASGDEALRALGT
AAYDVVLTDCRMPGMDGIALTAAIRAHPDARVRATPIVGVTALVSDAEHARCVDAGMTLC
IGKPTTLDALERALVEAIEPVPALRFDPSRIDAARLFAGFGASSAPGAARDAILLACGRA
LERDRDTLTRHLRDGLSERELRAWCHTARGTYSLFGQAHVDALLDEFHHLLTAGDARAIR
GATRDILAMVNHLLRCVAHSAQSRDRGDPKGGR
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcgacggcttttgcggaggcaaattctgtcgacgcatactcgtatgtctctgc
gcagcggcgctcgcgttcctgacgctgccgcagctgtccaaccggatgcaggagagcatg
ctgatcgcgactgagccctgcaagtggacgcatgtgtacccggtgctatggggcagccac
gtgctcgtcgcgctgttgagctacggatgggcgcaccgcgacctgaagcggctgcaagcg
gcgctcagagcgagccggggctcgctcgcgaccgcgagccacgaattgcgcgcgccggtg
aacggcatgctcgcgctcgtcgagctggtgaggcaggggctgctcgcgccggagcagcag
cggctgctcgggctcgtgcaggactcggggcagtcgctcgcgcgggtgctgaacgacatt
ctcgatcacgcgagcatcgaggcggggcaattcgcgatcgagaagacgcgtgtcgacgtg
cgcgagctcgtcgacagcgtgagcgcgatgctcgcggtgcacgcgcatcgcaagggtttg
cggctgcggctgcacgtcgatgccaacgtgcccgccgcggtgctgacggacggcaatcgg
ctgcggcagattctcgtcaacctgatcggcaacggcatcaagtacacggagcgcggcggc
gtgtcggtgcgcgtgcgcgcggcggacgacgtcgacggcatggtcgagctcgtcgcgacg
atcgtcgacacgggcatcggcattgccgccgacgagttgcggcggctgttcacgccgttc
gcgcgcgcgacgcgcggcgcacggcgcatggaatcgggaacggggctcgggcttgcgatc
gcgcgcaagctcgcgcgattgctgggaggggacgtgacgttgacgagtgacgaaggcagg
ggaacgacggcgaccgcgcgcattcgctgcgcggtcgcggcgcgcggctatgcgaacgat
gcgctcgcggggcgggtcgtgtcgatcgacgtgggcgacgccgcgctcgcggccacgctc
gccgcgtacgcgcgcgcggcgggcgtgcgggtggccgcgcgcggcgcgccggatgtcgag
gcggtgctgtgcgacgacgcgcgcgtcgatgcgtcgcgcacgcagctcggctgggtcggc
gtgaccgatgcgccggcgctcgccggctggaccgacagcggcacgcacgtgcgcctgagc
agcaatccgctcggctggcgagcgttcatcgacggcctgcgcgccgcgctcgacgcgcgc
gatgcgcgcgacgcggcgggcgcgcacacggcggcgcgggccgaaccgggcgcgtatcgg
gtgctcgtcgtcgacgatcaggagatgaatcgcatcgtgctgcgctatcagctcgacgcg
ctcggtcaccacgcgcgcctctgcgcgagcggcgacgaggcgttgcgcgcactcggcacg
gccgcgtacgacgtcgtgctcaccgactgccggatgccgggcatggacggcatcgcgctg
acggcggcgatccgtgcgcatccggatgcgcgcgtgcgcgcgacgcccatcgtcggcgtg
acggcgctcgtatcggacgccgagcatgcgcgctgcgtcgatgcgggcatgacgctgtgc
atcggcaagccgacgacgctcgacgcgctcgagcgtgcgctcgtcgaggcgatcgagccc
gtgcccgcgctgcgcttcgatccgtcgcgcatcgatgcggcgcgcctgttcgcgggattc
ggcgcgtcctccgcgccaggcgcggcgcgcgacgcgatcctgctcgcctgcggccgcgcg
ctcgaacgcgaccgggatacgctcacgcgccatctgcgcgacggcctgtccgagcgcgag
ctgcgcgcgtggtgccatacggcgcgcggcacgtacagcctgttcgggcaggcgcatgtc
gacgcgctgctcgacgaattccaccatctgctgacggcgggcgacgcgcgcgcgattcgc
ggcgcgacccgggacattctcgcgatggtgaaccatctgctgcgctgcgttgcgcattcg
gcgcaatcgcgcgatcgcggcgatccaaaaggaggaaggtaa

DBGET integrated database retrieval system