KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1642Help
Entry
BURPS1106A_1642   CDS       T00480                                 

Definition
(GenBank) drug:H+ antiporter-2 (DHA2) family protein
  KO
K03446  MFS transporter, DHA2 family, multidrug resistance protein
Organism
bpl  Burkholderia pseudomallei 1106a
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpl02000]
    BURPS1106A_1642
Transporters [BR:bpl02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    BURPS1106A_1642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: ABN90027
UniProt: A3NU92
Position
I:complement(1594446..1596065)
Genome map
AA seq 539 aa AA seqDB search
MNGSTPTPPAAPRRDRNGNGDGTWRPAANPWLIAVVVTLAAFMEVLDTTIVNVALPHIAG
TMSASYDEATWTLTSYLVANGIVLPISGFLGRLLGRKRYFVLCIVAFTICSFLCGIATDL
GQLIVFRVLQGLFGGGLQPNQQSIILDTFPPEQRNRAFSISAVAIVVAPVLGPTLGGWIT
DNFSWRWVFLLNVPIGVLTSLAVIQLVEDPPWKRGRARGLSIDYIGITLIAIGLGCLQVM
LDRGEDEDWFASTFIRTFAVLTVAGLVGATFWLLYAKKPVVDLSCLKDRNFALGCVTIAT
FAVVLYGSAVLVPQLAQQRLGYTAMLAGLVLSPGALLITLEIPIVSKLMPYVQTRFLVCF
GFLLLAASLVYSHTLVPDIDYPNLLKIRSAQSLAIGFLFVPITTLAYLTVPRRLNDDASA
LFTMFRNVAGSIGISLSTALIRERAQARMAHLSTHLSPLSQNFDDTLRQNAQTIASLSGM
PPPAALQTASGQLYETFVSQATILAYLDVFAMLAIFCFVCTPLTLLFSPVKAAGGPGGH
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaacggatcgacgcccaccccgcccgccgcaccgcgccgcgaccgcaacggcaacggc
gacggcacgtggcgtcccgccgcgaacccgtggctgatcgcggtcgtcgtcacgctcgcc
gcgttcatggaggtgctcgacacgacgatcgtcaacgtcgcgctgccgcacatcgccggc
acgatgtcggcgagctacgacgaagcgacctggacgctcacgtcgtatcttgtcgccaac
ggcatcgtgctgccgatctccggctttctcggccgcctgctcggccgcaagcgctacttc
gtgctgtgcatcgtcgcgttcacgatctgctcgttcctgtgcggaatcgcaaccgatctc
ggccaactgatcgtgttccgcgtgctgcaggggctgttcggcggcggcctgcagccgaac
cagcaatcgatcatcctcgatacgttcccgcccgagcagcgcaaccgcgcgttctcgatc
tcggccgtggcgatcgtcgtcgcgccggtgctcggcccgacgctcggcggctggatcacc
gacaacttctcgtggcgctgggtgttcctgctcaacgtgccgatcggcgtgctgacttcg
ctcgcggtgatccagctcgtcgaggatccgccgtggaaacgcggccgcgcgcgcggcctg
tcgatcgactacatcggcatcacgctgatcgcgatcggcctcggctgtctgcaggtgatg
ctcgatcgcggcgaggacgaggactggttcgcgtcgacgttcatccgcacgttcgcggtg
ctgaccgtcgcggggctcgtcggcgcgacgttctggctgctctacgcgaaaaagcccgtc
gtcgatctgtcgtgcctgaaggatcgcaatttcgcgctcggctgcgtgacgatcgcgacg
ttcgcggtcgtgctgtacggcagcgccgtgctcgtgccgcaactcgcgcagcagcggctc
ggctacacggcgatgctcgcgggtctcgtgctgtcgccaggcgcgctcctcatcacgctc
gagattccgatcgtcagcaagctgatgccgtacgtgcagacgcgctttctcgtatgcttc
ggcttcctgctgctcgccgcgtcgctcgtgtactcgcacacgctcgtgcccgacatcgac
tatccgaacctcctgaagatacgcagcgcgcaatcgctcgcgatcggcttcctgttcgtg
ccgatcacgacgctcgcgtatctgaccgtgccgcgccggctgaacgacgatgcgtccgcg
cttttcacgatgttccgcaatgtcgcgggatcgatcggcatttcgctgtcgaccgcgctg
attcgcgagcgcgcgcaggcgcgcatggcgcatctgtcgacgcacctgtcgccgctgtcg
cagaacttcgacgatacgctgcggcagaacgcgcagacgatcgcatcgctctcggggatg
ccgccgcccgccgcgctgcaaacggcgagcgggcagttgtacgagaccttcgtgtcgcag
gcgacgatcctcgcgtacctcgacgtgttcgcgatgctcgcgatcttctgcttcgtgtgc
acgcccctcacgctgcttttctcgcccgtgaaggcggcgggcggcccgggaggacactga

DBGET integrated database retrieval system